DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ZNF426 and CG12744

DIOPT Version :9

Sequence 1:	NP_077011.1	Gene:	ZNF426 / 79088	HGNCID:	20725	Length:	554	Species:	Homo sapiens
Sequence 2:	NP_610530.1	Gene:	CG12744 / 36024	FlyBaseID:	FBgn0033459	Length:	160	Species:	Drosophila melanogaster

Alignment Length:	116	Identity:	33/116 - (28%)
Similarity:	47/116 - (40%)	Gaps:	9/116 - (7%)

- Green bases have known domain annotations that are detailed below.

Human   383 IRTHTGEKPFVCVECGKAFAVSSNLSGHLRTHTEEKAC---ECKICGKVFGYPSCLNNH-MRTHS 443
            :.|...|....|:.|.:.|..:..|..||.||..:...   .|.|||:.......|:.| .|.|.
  Fly     1 METALAEVQLSCLLCEQTFDATEKLDEHLPTHFPQPVSTGQTCDICGRTMRSSLELHQHYKRYHE 65

Human   444 AQKPYT-----CKECGKAFNYSTHLKIHMRIHTGEKPYECKQCGKAFSHSS 489
            |..|.|     |:.|.|.|....|||:|::|......|:..:....:.|.|
  Fly    66 AHVPNTEGHFQCQLCDKVFLLQDHLKVHVKIEHATDGYQPDEKSLDWQHYS 116

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ZNF426	NP_077011.1	KRAB	42..98	CDD:214630
		C2H2 Zn finger	148..168	CDD:275368
		C2H2 Zn finger	176..214	CDD:275368
		zf-C2H2	224..246	CDD:306579
		C2H2 Zn finger	226..246	CDD:275368
		C2H2 Zn finger	282..302	CDD:275368
		zf-H2C2_2	294..319	CDD:316026
		C2H2 Zn finger	310..330	CDD:275368
		COG5048	<334..486	CDD:227381	31/111 (28%)
		C2H2 Zn finger	338..358	CDD:275368
		C2H2 Zn finger	366..386	CDD:275368	0/2 (0%)
		C2H2 Zn finger	394..414	CDD:275368	6/19 (32%)
		C2H2 Zn finger	422..442	CDD:275368	7/20 (35%)
		C2H2 Zn finger	450..470	CDD:275368	8/19 (42%)
		C2H2 Zn finger	478..498	CDD:275368	2/12 (17%)
		zf-H2C2_2	490..515	CDD:316026	33/116 (28%)
		C2H2 Zn finger	506..526	CDD:275368
		C2H2 Zn finger	534..554	CDD:275368
CG12744	NP_610530.1	C2H2 Zn finger	12..32	CDD:275368	6/19 (32%)
		C2H2 Zn finger	43..64	CDD:275368	7/20 (35%)
		C2H2 Zn finger	77..96	CDD:275368	8/18 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910