DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REEP5 and CG5539

DIOPT Version :10

Sequence 1:NP_005660.4 Gene:REEP5 / 7905 HGNCID:30077 Length:189 Species:Homo sapiens
Sequence 2:NP_611831.2 Gene:CG5539 / 37766 FlyBaseID:FBgn0034907 Length:296 Species:Drosophila melanogaster


Alignment Length:128 Identity:38/128 - (29%)
Similarity:62/128 - (48%) Gaps:13/128 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    43 GLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFL 107
            |||:.:|.|.||.      :|   ||:.:.|.:.| ..|:...|..||:||......|..:|:||
  Fly     5 GLVSQFLFFVYGT------MG---PAWQTYKTLNS-GDEEFLAWAKYWIVYAFLVTFEVLADVFL 59

Human   108 SWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAI 170
            ||.|.|...|...::|.:..:|:... .::..|:||...|.:.::|..:.  :.|.|...||:
  Fly    60 SWLPLYMPTKLLLVVWIVLSAPAANV-WIFDAILRPVLAKRQEEIDHFLH--RGKEKLLIDAL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REEP5NP_005660.4 TB2_DP1_HVA22 67..144 CDD:460820 23/76 (30%)
Required for dimerization and maintaining endoplasmic reticulum morphology. /evidence=ECO:0000269|PubMed:32075961 114..185 12/57 (21%)
CG5539NP_611831.2 TB2_DP1_HVA22 20..94 CDD:460820 22/75 (29%)

Return to query results.
Submit another query.