DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REEP5 and Reepl1

DIOPT Version :10

Sequence 1:NP_005660.4 Gene:REEP5 / 7905 HGNCID:30077 Length:189 Species:Homo sapiens
Sequence 2:NP_572730.1 Gene:Reepl1 / 32103 FlyBaseID:FBgn0030313 Length:240 Species:Drosophila melanogaster


Alignment Length:98 Identity:32/98 - (32%)
Similarity:52/98 - (53%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    49 LVFGYGASLLCNLIGFGYPAYISIKAIESPN--KEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFP 111
            :::.....:|..|:|..|||:.|.|.::|.|  ..|...||.||:.|||:...::|:...|::.|
  Fly     1 MIYAIVIHILSLLVGCFYPAFASYKILKSQNCSVNDLRGWLIYWIAYGVYVAFDYFTAGLLAFIP 65

Human   112 FYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPF 144
            .....|...|.| |.||...|:|::|:..:|.|
  Fly    66 LLSEFKVLLLFW-MLPSVGGGSEVIYEEFLRSF 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REEP5NP_005660.4 TB2_DP1_HVA22 67..144 CDD:460820 27/78 (35%)
Required for dimerization and maintaining endoplasmic reticulum morphology. /evidence=ECO:0000269|PubMed:32075961 114..185 11/31 (35%)
Reepl1NP_572730.1 TB2_DP1_HVA22 19..97 CDD:460820 27/78 (35%)

Return to query results.
Submit another query.