DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCTD15 and kctd15

DIOPT Version :10

Sequence 1:XP_047295348.1 Gene:KCTD15 / 79047 HGNCID:23297 Length:299 Species:Homo sapiens
Sequence 2:NP_989239.1 Gene:kctd15 / 394848 XenbaseID:XB-GENE-944069 Length:255 Species:Xenopus tropicalis


Alignment Length:44 Identity:16/44 - (36%)
Similarity:19/44 - (43%) Gaps:8/44 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   235 ISAASSP-SPSASQ----PG-AASSEAPG--PVGAGLEEPSAAT 270
            :|...|| ||.|:|    |. ...|.||.  .||..:...|.||
 Frog     4 LSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLAT 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCTD15XP_047295348.1 None
kctd15NP_989239.1 BTB_POZ_KCTD15 29..127 CDD:349696 7/19 (37%)

Return to query results.
Submit another query.