DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Birc3 and Bruce

DIOPT Version :9

Sequence 1:NP_076477.3 Gene:Birc3 / 78971 RGDID:621282 Length:638 Species:Rattus norvegicus
Sequence 2:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster


Alignment Length:147 Identity:50/147 - (34%)
Similarity:71/147 - (48%) Gaps:29/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat   202 MNTEKARLLTYQTWP---LSFLSPAELAKAGFYY---TGPGDRVACFACGGKLSNWDRKDDPLSE 260
            |::|..|..|::.||   ..:..|.::|:||||:   :...||..||.|...|..|::.|:|.||
  Fly   245 MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSE 309

  Rat   261 HRRHFPSCPFLKDVGQFTSQYTVSNLSMQTHAARVRTFSTWPSSALVHPQELASAGFYYTGHSD- 324
            |.||.|.|||:|  |::|....:|           .|::|.|  ||..|    ..||....:|| 
  Fly   310 HERHSPLCPFVK--GEYTQNVPLS-----------ITYATNP--ALPAP----GLGFDIISNSDY 355

  Rat   325 -DVKCFCCD--GGLRCW 338
             :|.|..|.  |.|..|
  Fly   356 ANVLCTSCSQTGELSVW 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Birc3NP_076477.3 BIR 68..133 CDD:395528
BIR 206..272 CDD:237989 28/71 (39%)
BIR 290..358 CDD:197595 16/53 (30%)
UBA_BIRC2_3 412..461 CDD:270577
DD 476..564 CDD:417479
RING-HC_BIRC2_3_7 585..638 CDD:319627
BruceNP_001262460.1 BIR 251..321 CDD:279047 28/69 (41%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.