DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB7A and Rab26

DIOPT Version :10

Sequence 1:NP_004628.4 Gene:RAB7A / 7879 HGNCID:9788 Length:207 Species:Homo sapiens
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:59 Identity:13/59 - (22%)
Similarity:25/59 - (42%) Gaps:9/59 - (15%)


- Green bases have known domain annotations that are detailed below.


Human  1530 EICWGKVFEILEEAKVLFKLED--------YSVKQVTLEQIFLTFANTDKMKTYREIKL 1580
            |:..|.:.:|::|..:...|.|        .:||....|:........| .:|:|::.|
  Fly     3 EVSLGMLIDIVDEEWMRDTLPDDDLPLPPVLAVKTDDTEETNQETQQAD-AETWRDLAL 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB7ANP_004628.4 Rab7 9..179 CDD:206655
Switch 1. /evidence=ECO:0000269|PubMed:15933719, ECO:0007744|PDB:1T91, ECO:0007744|PDB:1YHN 28..41
Switch 2. /evidence=ECO:0000269|PubMed:15933719, ECO:0007744|PDB:1T91, ECO:0007744|PDB:1YHN 67..82
Rab26NP_001097658.1 Rab26 214..407 CDD:206695
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.