DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB7A and ypt7

DIOPT Version :9

Sequence 1:NP_004628.4 Gene:RAB7A / 7879 HGNCID:9788 Length:207 Species:Homo sapiens
Sequence 2:NP_596307.1 Gene:ypt7 / 2540763 PomBaseID:SPBC405.04c Length:205 Species:Schizosaccharomyces pombe


Alignment Length:209 Identity:135/209 - (64%)
Similarity:169/209 - (80%) Gaps:6/209 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTA 65
            |..:||.||||||||:|||||||:||||||:|||..||||||||||||||:|||::||:|:||||
pombe     1 MAGKKKHLLKVIILGESGVGKTSIMNQYVNRKFSKDYKATIGADFLTKEVLVDDKVVTLQLWDTA 65

Human    66 GQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLE 130
            ||||||||||||||||||||||:||....:|:|||||||||||||||.:||.|||::||||:|:|
pombe    66 GQERFQSLGVAFYRGADCCVLVYDVNNSKSFETLDSWRDEFLIQASPSNPETFPFILLGNKVDVE 130

Human   131 --NRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLD 193
              .|.|:..:|.|:|.::..||||||||||||||::||:|:|:.||:.....::..:|.:||.||
pombe   131 EQKRMVSKSKALAFCQARGEIPYFETSAKEAINVQEAFETVAKLALENMDSDDIAADFTDPIHLD 195

Human   194 KNDRAKASAESCSC 207
                .::...||.|
pombe   196 ----MESQKTSCYC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB7ANP_004628.4 Rab7 9..179 CDD:206655 123/171 (72%)
Effector region. /evidence=ECO:0000250 37..45 7/7 (100%)
ypt7NP_596307.1 Rab7 9..181 CDD:206655 123/171 (72%)
RAB 9..178 CDD:197555 123/168 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 257 1.000 Domainoid score I440
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3408
Inparanoid 1 1.050 277 1.000 Inparanoid score I784
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 1 1.000 - - oto146267
orthoMCL 1 0.900 - - OOG6_101358
Panther 1 1.100 - - LDO PTHR47981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2001
SonicParanoid 1 1.000 - - X1058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.