DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEMA3B and Sema1b

DIOPT Version :9

Sequence 1:NP_001276990.1 Gene:SEMA3B / 7869 HGNCID:10724 Length:754 Species:Homo sapiens
Sequence 2:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster


Alignment Length:561 Identity:171/561 - (30%)
Similarity:271/561 - (48%) Gaps:56/561 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     3 RAGAAAV----IPGLALLWAVGLGSAAPSPPRLRLSFQELQAWHGLQTFSLERTCCYQALLVDEE 63
            |..:||:    ||.:.|:...||...|...|.::...|..|. ..|..|....|..::  ::|..
  Fly     6 RPSSAAMLVNAIPMILLITLSGLTIVAGWMPDVKPDLQTKQD-KVLAHFIGNSTDYFK--ILDHN 67

Human    64 RGRLFVGAENHVASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLLHAYNRTHL 128
            ...:.|||::.:.:::|:.: |...:|.|.:....||.|...||. ..:|.|::::........:
  Fly    68 DEFVLVGAKDVIYNVSLNGL-KEIARLEWHSTDADRELCALKGKH-EWDCHNYLRVYALRPNGEV 130

Human   129 LACGTGAFHPTC--------AFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRAASVLVGEEL 185
            |.|||.::.|.|        :..|.|.......:|.:..|..:.:|..||.|.|.:........|
  Fly   131 LLCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGLCPYSPAHNSTYAFADGHL 195

Human   186 YSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA 250
            ||...||..|.|..|:|.     :||||.:|.:.||:|.||...       ..:..:.|||||.:
  Fly   196 YSATVADFSGGDPLIYRE-----NLRTEQYDLKQLNQPDFVGAI-------ERNGYVLFFFRELS 248

Human   251 VEAAPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVCSVPGVEGDTHFDQLRPFPAEDV 315
            :|.. ..|:...|||.::|:||.||..|....||:||||||.||||| |...:||:::..  ..:
  Fly   249 MEVM-NFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPG-EFPFYFDEIQAI--SPI 309

Human   316 FLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRAFLGPFAHKEGPMHQWVSYQ-GRVPY 379
            ....|:.    |:||||:||.:...|||||.::::|:..||.|.|..::.....|:..: .:||.
  Fly   310 VESGSKS----LIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWLPVEREQVPK 370

Human   380 PRPGMC--PSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPTGGRPLFLQVGANYTFTQIAA-D 441
            ||||.|  .|:|..:.:         :.|.:|||||..:|....||||..:|..::..|.||. .
  Fly   371 PRPGQCVEDSRTLTSIA---------VNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRLTAIAVHP 426

Human   442 RVAAADG-HYDVLFIGTDVGTVLKVISV----PKGSRPSAEGLLLEELHVFEDSAAVTSMQISSK 501
            :|.:..| :|||::.|||.|.|.|.|::    |..:....:.:::.|:.|......:..:.||:.
  Fly   427 QVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLGTPIRELVISTS 491

Human   502 RHQLYVASRSAVAQIALHRCAAHGRVCTECCLARDPYCAWD 542
            ::.|.|.|..::..:.||.| :|...|..|...:||.||||
  Fly   492 KNSLVVVSDGSLVSVPLHHC-SHIVDCLGCLSLQDPICAWD 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEMA3BNP_001276990.1 Sema 46..521 CDD:301699 148/491 (30%)
PSI 520..>556 CDD:214655 10/23 (43%)
Ig_Semaphorin_classIII 580..670 CDD:143279
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 707..754
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 147/488 (30%)
PSI 510..>537 CDD:214655 10/23 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.