DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FZD5 and Corin

DIOPT Version :9

Sequence 1:NP_003459.2 Gene:FZD5 / 7855 HGNCID:4043 Length:585 Species:Homo sapiens
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:330 Identity:70/330 - (21%)
Similarity:116/330 - (35%) Gaps:76/330 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    30 AP-VCQEITVPMCRG--IGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYT 91
            || .|..|.|..|:|  |.||.|..||...|..|.|...::..:..||:::|...:..|||:::.
  Fly   775 APGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFV 839

Human    92 PICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRS--E 154
            |.| ......:|||:::|......|......:|.:.||.::|..........:.:.:|..|.  .
  Fly   840 PKC-GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVREVMR 903

Human   155 ATTAPP---------RPFPAKPTLPGPPGA--PASGGECPAGGPFVCKCREPFVPILKESHPLYN 208
            |.|.|.         |..|.:....|....  .|...:|...||....|.:.            .
  Fly   904 AATHPKCDGFQCDQNRCLPQEYVCDGHLDCMDQADEAKCERCGPDEIYCGDS------------Q 956

Human   209 KVRTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIF 273
            .:.|..:.:..:.|   .:..|||          :.|.....:..|.|.::::  :|..:|.  :
  Fly   957 CIGTKHICDGIIDC---PYGQDER----------NCLRLSERNGDVGTGVLEV--YRIGQRQ--W 1004

Human   274 LSACY-----------LCVSLGFLVRLVVGHASVACSREHNHIHYETTGPALCTIVFLLVYFFGM 327
            :.||.           :|..||:   ..|...||.....|.        |.|.|:        .:
  Fly  1005 MPACVKNWDRAVSPSAVCSILGY---SAVNATSVLTQLTHR--------PLLATV--------NV 1050

Human   328 ASSIW 332
            ::.||
  Fly  1051 STDIW 1055

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FZD5NP_003459.2 TM helix 5 397..426 CDD:320377
TM helix 6 446..473 CDD:320377
TM helix 7 496..521 CDD:320377
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 525..530
PDZ-binding 583..585
CRD_FZ5 29..156 CDD:143569 35/130 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 156..179 6/33 (18%)
7tmF_FZD5 225..535 CDD:320377 22/119 (18%)
TM helix 1 234..259 CDD:320377 3/24 (13%)
TM helix 2 268..289 CDD:320377 6/31 (19%)
TM helix 3 316..342 CDD:320377 3/17 (18%)
TM helix 4 359..375 CDD:320377
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 31/116 (27%)
LDLa 911..942 CDD:238060 4/30 (13%)
LDLa 945..979 CDD:238060 8/58 (14%)
SR 980..>1034 CDD:214555 11/60 (18%)
SRCR 992..1086 CDD:278931 16/87 (18%)
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.