DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FZD5 and smo

DIOPT Version :9

Sequence 1:NP_003459.2 Gene:FZD5 / 7855 HGNCID:4043 Length:585 Species:Homo sapiens
Sequence 2:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster


Alignment Length:529 Identity:138/529 - (26%)
Similarity:234/529 - (44%) Gaps:88/529 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    41 CRG--IGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEI-QCSPDLRFFLCSMYTPIC-------- 94
            |.|  :.|.|:.:.....| |:.|...:::.::.|..: :|...::.|||:::.|.|        
  Fly   100 CFGSKLPYELSSLDLTDFH-TEKELNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDM 163

Human    95 --LPDYHK---PLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSE 154
              ||.|..   .:.|||            ::....| :|:.:.|:         |.|        
  Fly   164 VYLPSYEMCRITMEPCR------------ILYNTTF-FPKFLRCN---------ETL-------- 198

Human   155 ATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCA 219
                    ||.|.| .|..|...:|         ..:|..|.|| ...|...|..:.     .|.
  Fly   199 --------FPTKCT-NGARGMKFNG---------TGQCLSPLVP-TDTSASYYPGIE-----GCG 239

Human   220 VPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERF-RYPERPIIFLSACYLCVSL 283
            |.|..|.::.||.......||....:|.:|....|:||.||.:.. :||...:.:::.|:|...:
  Fly   240 VRCKDPLYTDDEHRQIHKLIGWAGSICLLSNLFVVSTFFIDWKNANKYPAVIVFYINLCFLIACV 304

Human   284 GFLVRLVVG-HASVACSREHNHIHYE-TTGPAL-CTIVFLLVYFFGMASSIWWVILSLTWFLAAG 345
            |:|::...| ...:.|.::....|.| |.|..| |.::|:|||:|..|..:|:|.|:..|...| 
  Fly   305 GWLLQFTSGSREDIVCRKDGTLRHSEPTAGENLSCIVIFVLVYYFLTAGMVWFVFLTYAWHWRA- 368

Human   346 MKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVL 410
            |....:.|.....||||.||.:|.|.:||.:|.|.|||:.:.|||:||..|.:...|.:||||..
  Fly   369 MGHVQDRIDKKGSYFHLVAWSLPLVLTITTMAFSEVDGNSIVGICFVGYINHSMRAGLLLGPLCG 433

Human   411 YLLVGTLFLLAGFVSLFRIRSVIK--QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQH 473
            .:|:|..|:..|.|.||.::....  :..:.::|:..:::|:|:..||..|...:.:||::.|..
  Fly   434 VILIGGYFITRGMVMLFGLKHFANDIKSTSASNKIHLIIMRMGVCALLTLVFILVAIACHVTEFR 498

Human   474 YRESWEAALT--CACPGHDTGQPRA------KPEYWVLMLKYFMCLV-VGITSGVWIWSGKTVES 529
            :.:.|..:..  ..|......:.::      :|...||.| :.:||. .||....|.|:..::|:
  Fly   499 HADEWAQSFRQFIICKISSVFEEKSSCRIENRPSVGVLQL-HLLCLFSSGIVMSTWCWTPSSIET 562

Human   530 WRRFTSRCC 538
            |:|:..:.|
  Fly   563 WKRYIRKKC 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FZD5NP_003459.2 TM helix 5 397..426 CDD:320377 10/28 (36%)
TM helix 6 446..473 CDD:320377 8/26 (31%)
TM helix 7 496..521 CDD:320377 8/31 (26%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 525..530 1/4 (25%)
PDZ-binding 583..585
CRD_FZ5 29..156 CDD:143569 25/130 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 156..179 6/22 (27%)
7tmF_FZD5 225..535 CDD:320377 96/324 (30%)
TM helix 1 234..259 CDD:320377 7/24 (29%)
TM helix 2 268..289 CDD:320377 4/20 (20%)
TM helix 3 316..342 CDD:320377 10/25 (40%)
TM helix 4 359..375 CDD:320377 9/15 (60%)
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 33/169 (20%)
Frizzled 246..568 CDD:279827 95/323 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509772at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.