DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CXCR4 and FMRFaR

DIOPT Version :9

Sequence 1:NP_001334985.1 Gene:CXCR4 / 7852 HGNCID:2561 Length:423 Species:Homo sapiens
Sequence 2:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster


Alignment Length:414 Identity:81/414 - (19%)
Similarity:162/414 - (39%) Gaps:69/414 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     9 PLPNV-PNAPSDKHEDGK-RPTHRRSARLGEEVPFVHFLTLPPNIPQAPKGLRFKTAFSLPTTS- 70
            |.|.| |..|:|....|. ......::.:..|.|.|.:...|.|..|             ||.. 
  Fly    16 PSPGVMPPPPTDYDYGGPISDDEFLASAMATEGPTVRYDLFPQNNSQ-------------PTLQI 67

Human    71 CLKPRMIYTSDNYT--EEMG---SGDYDSMKEPCFRE--ENANFNKIFLPTIYSIIFLTGIVGNG 128
            .|....:.|...|.  |::|   ..::..:.|..:..  ||..........:.:|:.:.||:||.
  Fly    68 VLNHTEVQTDLQYPHYEDLGLDPDPNWTRICEDVYNPLLENNRIEFWVCGVLINIVGVLGILGNI 132

Human   129 LVILVMGYQKKLRSMTDKYRLHLSVADLLFVIT------LPFWAVDAVANWYFG------NFLCK 181
            :.::::. :.::||..:.....|:..|.:.:||      :|  ::......:||      .|:..
  Fly   133 ISMIILS-RPQMRSSINYLLTGLARCDTVLIITSILLFGIP--SIYPYTGHFFGYYNYVYPFISP 194

Human   182 AVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDF--- 243
            ||..|..:...:|:.:...::|:||:|:.|...::........|:.::.....:|...:|.|   
  Fly   195 AVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEV 259

Human   244 IFANVSEADDRYI--C---DRFYPNDLWVVVF-QFQHIMVGLILPGIVILSCYCIII-------- 294
            :.....|.....|  |   .|...::.::.:: .:.:::|..|:|.:.:....|:|.        
  Fly   260 LTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRANR 324

Human   295 --SKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISI 357
              .:||.|:..:...|.....::|:.|...:||..:.|| ::|           :....||...|
  Fly   325 ERQRLSRSEKREIGLATMLLCVVIVFFMLNFLPLVLNIS-EAF-----------YSTIDHKITKI 377

Human   358 TEALAFFHCCLNPILYAFLGAKFK 381
            :..|...:..:|.::|...|.|||
  Fly   378 SNLLITINSSVNFLIYIIFGEKFK 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CXCR4NP_001334985.1 CXCR4_N 77..109 CDD:314911 7/38 (18%)
7tmA_CXCR4 110..384 CDD:320307 58/303 (19%)
TM helix 1 110..137 CDD:320307 5/26 (19%)
TM helix 2 144..169 CDD:320307 5/30 (17%)
TM helix 3 180..210 CDD:320307 8/29 (28%)
TM helix 4 222..244 CDD:320307 4/24 (17%)
TM helix 5 267..296 CDD:320307 5/39 (13%)
TM helix 6 303..333 CDD:320307 7/29 (24%)
TM helix 7 352..377 CDD:320307 6/24 (25%)
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 53/286 (19%)
7tm_1 130..393 CDD:278431 50/277 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.