DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IL1R2 and CG45263

DIOPT Version :9

Sequence 1:XP_011510103.1 Gene:IL1R2 / 7850 HGNCID:5994 Length:441 Species:Homo sapiens
Sequence 2:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster


Alignment Length:366 Identity:72/366 - (19%)
Similarity:123/366 - (33%) Gaps:93/366 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    78 YKREFRLEGEP----------VALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQ 132
            |....||.|.|          :.|||.       |..:|..::.|.:...:. :...:||     
  Fly   283 YAPSIRLIGSPEIDLEEDKDALVLRCV-------ADANPPASIVWRRAGRSE-IASLQET----- 334

Human   133 DGALWLLPALQEDSGTYVCTTRNA-SYCDKMSIELRVFENTDAFLPFISYPQILTLS----TSGV 192
               |.|.|..:.|:|.|.|..:|: ...:::|::|      |...|    |:|::..    |:..
  Fly   335 ---LQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQL------DVKYP----PKIISAGPDRLTTAP 386

Human   193 LVCPDLSEFTRDKTDV-KIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAH 256
            |..|...|...|...: ..:|.:..    ....|::.....:.|::.:|..|..|.|.|..|...
  Fly   387 LFSPAAFECLADGNPLPSFKWVQRM----AHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYI 447

Human   257 EGQQYNITRSIELRIKKKKEETIPVIISP--------LKTISASLGSRLTIPCKVFLGTGTPLTT 313
            .||:         |:......::.|:.:|        |.|:|...|...::...|   ...|...
  Fly   448 NGQE---------RVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVV---CADPRPQ 500

Human   314 MLWWTANDTHIESAYPGGRVTEGPRQEYSENNENYIEVPLIFDPVTREDLHMDFKCVVHNT---- 374
            .:.|......:|:.....|......|                 |.||||.::....::|..    
  Fly   501 RVAWEWGSLRLEAGSGIDRFRADDMQ-----------------PDTREDCYLSTLHILHADEHDS 548

Human   375 ----LSFQTLRTTVKEASSTFSWGIVLAPLSLAFL--VLGG 409
                |..:..|.|.:.|......|....|..:::|  |.||
  Fly   549 RPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGG 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IL1R2XP_011510103.1 PHA02785 49..370 CDD:165149 61/315 (19%)
Ig1_IL1R_like 73..168 CDD:143233 23/100 (23%)
Ig2_IL1R2_like 179..273 CDD:143305 19/98 (19%)
ig 284..384 CDD:278476 19/115 (17%)
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845
IG_like 302..368 CDD:214653 18/87 (21%)
IGc2 302..357 CDD:197706 16/70 (23%)
Ig 372..446 CDD:299845 16/77 (21%)
Ig 475..568 CDD:299845 20/112 (18%)
IG_like 478..570 CDD:214653 19/111 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.