DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PXDN and CG42331

DIOPT Version :9

Sequence 1:NP_036425.1 Gene:PXDN / 7837 HGNCID:14966 Length:1479 Species:Homo sapiens
Sequence 2:NP_001189281.1 Gene:CG42331 / 42948 FlyBaseID:FBgn0259233 Length:1615 Species:Drosophila melanogaster


Alignment Length:873 Identity:286/873 - (32%)
Similarity:388/873 - (44%) Gaps:171/873 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   614 PDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFDSRPRSPNDLLALFRYP------RDPYTVEQ 672
            |::.|||..                       |.|:.|.:   :|:.|..|      |:......
  Fly    93 PEMLRNGQT-----------------------LQDNHPAA---MLSRFNAPTTDSERREMAAYAT 131

Human   673 ARAGEIFERTLQLIQE--HVQHGLMVDLNGTSYHYNDLVSPQYLNLIANLSGCTAHRRVNNCSDM 735
            ..|.:.|.:..|.|.|  ...|...:.|..|:                 |.|....|....|  |
  Fly   132 IAAAKAFRKNFQHIDELARQSHTQRISLRRTA-----------------LEGLCPPRDPPPC--M 177

Human   736 CFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRGINPHRLYNGHALPMPRLVST 800
            ...::||||||||||.:.|.|||:...|.|.|...|.:|.:|.|.     ..:|..|...|.||.
  Fly   178 PASERYRTHDGTCNNKRRPRWGAAQMPFNRFLPPEYGDGVDTVRS-----SADGSTLSSSRFVSL 237

Human   801 TLIGT-ETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQ--HCSNVCSNDPPCFSVMI 862
            .:.|. |...|   .|.|:.||||.||||:.||    :|.|..:|.  .|.......|.||.:.:
  Fly   238 LVHGAREGEAP---LTLMIAQWGQMLDHDMTST----AQPRSINGSIPSCCGGKDFHPACFPIKV 295

Human   863 PPNDS-RARSGARCMFFVRSSPV----CGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSTEHE 922
            |.:|. .|....||:.|:||:|.    |....          |||.||:|||||||.:|.::...
  Fly   296 PLDDPWLAPLKVRCLEFLRSAPAQRRDCVLSW----------REQTNQVTSYIDASPIYSNSAKS 350

Human   923 ARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSM 987
            :.:.|       :.|.|        ||.:..|.|.|.:.........|..:||.|:.||.||.:|
  Fly   351 SDNAR-------VFRHG--------LLVYGRGDPAEDVCQRGAIATKCIRSGDGRSGEQPGLLAM 400

Human   988 HTLWFREHNRIATELLKLNPHWDGDTIYYETRKIVGAEIQHITYQHWLPKILG-------EVGMR 1045
            |.:|..||||||.||.:|||||..:.:|.|||:||||..||||::.:||.|||       ::.:.
  Fly   401 HHVWVGEHNRIAMELSELNPHWSDEKVYQETRRIVGAMFQHITFREFLPVILGREVVKLFDLELM 465

Human  1046 TLGEYHGYDPGINAGIFNAFATAAFRFGHTLVNPLLYRLDENFQPIAQDHLPLHKAFFSPFRIVN 1110
            ..|.|..|...:|..:.||||.|||||||:||.....|.|.:.. :..:::.||:. |....|.:
  Fly   466 PSGYYERYSSKVNPTVANAFAAAAFRFGHSLVQNSYTRCDRHHN-VINNNVSLHEE-FQRGDIGS 528

Human  1111 EGGIDPLLRGLFGVAGKMRVPSQLLNTELTERLF-SMAHTVALDLAAINIQRGRDHGIPPYHDYR 1174
            .|.:..|||||.......|  .:.:..|||..|| :......||||||||||||||||.||..:|
  Fly   529 AGSLHRLLRGLASQRALKR--DEFITPELTNHLFQTPGFPFGLDLAAINIQRGRDHGIAPYSAWR 591

Human  1175 VYCNLSAAHTFEDLKNEIKNPEIREKLKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQ 1239
            |.|.||...:::|..| :..||..:::...|.|..:||||...:.|..|.|..:|||..|:::.|
  Fly   592 VPCGLSPILSWDDFAN-VVGPESAKRIGHAYRSVHDIDLFVGGIAERPVVGGLVGPTFACIIAQQ 655

Human  1240 FKRLRDGDRLWYENPGV---FSPAQLTQIKQTSLARILCDNADNITRVQSDVFRVAEFPH----- 1296
            |...|.|||.||||.|.   |:||||..:::.|||::||......| :|..:|..|||..     
  Fly   656 FSNSRRGDRFWYENGGFESSFTPAQLHSLRRVSLAQVLCRTVGGGT-LQPHIFIPAEFEDNERQT 719

Human  1297 -GYGSCDEIPRVDLRVW--------QDCCEDCRTRGQFNAFSYHFRGRRSLEFSYQEDKP--TKK 1350
             |.||   :..:||..|        |...|...|.||....|...         .:|||.  :.:
  Fly   720 CGVGS---LSPIDLSPWLEQDPFHNQQVPEQVFTIGQPELGSVQI---------IKEDKAGFSNR 772

Human  1351 TRPRKIPSVGRQGEHLSNSTSAFSTRSDASGTN-----DFREFVLEMQKTITDLRTQIKK--LES 1408
            .:|.| |.|    |...:|.|.|...::.:.|.     |.|      :||:|      ||  ..:
  Fly   773 VKPIK-PQV----EVSPSSLSGFHRPTNENLTKVSDKLDLR------RKTVT------KKNNTNN 820

Human  1409 RLSTTECVDAGGESHANNTKWKKDACTI 1436
            |..||. ...||   .||...|....|:
  Fly   821 RQQTTR-KPVGG---VNNKLDKSPKITL 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PXDNNP_036425.1 leucine-rich repeat 45..63 CDD:275380
leucine-rich repeat 66..87 CDD:275380
LRR 1 87..108
LRR_4 110..151 CDD:289563
LRR_8 111..170 CDD:290566
LRR 2 111..132
leucine-rich repeat 112..135 CDD:275378
LRR_4 135..175 CDD:289563
LRR 3 135..156
leucine-rich repeat 136..159 CDD:275378
LRR_8 158..>195 CDD:290566
LRR 4 159..180
leucine-rich repeat 160..183 CDD:275378
leucine-rich repeat 184..196 CDD:275378
TPKR_C2 192..243 CDD:301599
Ig 246..333 CDD:299845
I-set 246..333 CDD:254352
I-set 342..429 CDD:254352
Ig 346..429 CDD:299845
I-set 433..519 CDD:254352
Ig3_Peroxidasin 446..519 CDD:143222
I-set 525..611 CDD:254352
Ig4_Peroxidasin 542..610 CDD:143223
An_peroxidase 741..1282 CDD:281139 216/559 (39%)
peroxidasin_like 864..1303 CDD:188658 176/460 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1342..1380 11/39 (28%)
VWC 1415..1470 CDD:214564 6/22 (27%)
CG42331NP_001189281.1 An_peroxidase 183..699 CDD:281139 216/557 (39%)
peroxinectin_like 328..696 CDD:188655 158/387 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.