DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbd7 and anox

DIOPT Version :9

Sequence 1:NP_084339.1 Gene:Acbd7 / 78245 MGIID:1925495 Length:88 Species:Mus musculus
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:76 Identity:26/76 - (34%)
Similarity:38/76 - (50%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 FDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIACPAMLDLKGKAKWEAWNLQKGLSKEDA 71
            |..|.:.|.|..:.....:|...||.|||:..|......|.:|.|:.|:||:||.....:|:..|
  Fly    13 FHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAA 77

Mouse    72 MCAYISKAREL 82
            ..||:.|.:||
  Fly    78 RQAYVQKLQEL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbd7NP_084339.1 ACBP 3..87 CDD:381873 26/76 (34%)
Acyl-CoA binding. /evidence=ECO:0000250 30..34 2/3 (67%)
anoxNP_001027085.1 ACBP 10..90 CDD:279259 26/76 (34%)
ANK 125..231 CDD:238125
Ank_2 125..212 CDD:289560
ANK repeat 148..179 CDD:293786
ANK repeat 181..212 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.