DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSDE1 and rap-2

DIOPT Version :10

Sequence 1:NP_001229820.1 Gene:CSDE1 / 7812 HGNCID:29905 Length:844 Species:Homo sapiens
Sequence 2:NP_506707.2 Gene:rap-2 / 180011 WormBaseID:WBGene00004308 Length:181 Species:Caenorhabditis elegans


Alignment Length:96 Identity:25/96 - (26%)
Similarity:33/96 - (34%) Gaps:31/96 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   394 REMGVIAAMRDGFG------------FIKCVDRDVRMFFH----------FSEILD--GNQ---- 430
            ||..|:.....|.|            ||:..|..:..|:.          ..||||  |.:    
 Worm     2 REFKVVVLGSGGVGKSALTVQFVSSTFIEKYDPTIEDFYRKEIEVDGQPSVLEILDTAGTEQFSS 66

Human   431 ---LHIADEVEFTVVPDMLSAQRNHAIRIKK 458
               |:|.:...|.||..:.|.|..|.||..|
 Worm    67 MRDLYIKNGQGFVVVYSITSQQTFHDIRNMK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSDE1NP_001229820.1 CSD 72..136 CDD:278729
CSD 232..294 CDD:278729
CSP 396..459 CDD:214633 23/94 (24%)
CSD 567..628 CDD:278729
CSD 720..784 CDD:278729
SUZ-C 802..832 CDD:463745
rap-2NP_506707.2 Rap2 16..165 CDD:133376 20/82 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.