DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP4A1 and PRL-1

DIOPT Version :9

Sequence 1:NP_001372194.1 Gene:PTP4A1 / 7803 HGNCID:9634 Length:184 Species:Homo sapiens
Sequence 2:NP_001260487.1 Gene:PRL-1 / 34952 FlyBaseID:FBgn0024734 Length:176 Species:Drosophila melanogaster


Alignment Length:129 Identity:74/129 - (57%)
Similarity:96/129 - (74%) Gaps:0/129 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     6 RPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPF 70
            ||||..:.||.|:||||..|::.|:|.:|.||||..|.|:|||||.:|:|..:|.:||.|.|..|
  Fly    11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAF 75

Human    71 DDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIR 134
            :||..|..|:||:|..::|.|:::.|..|:|||||||||||||||||||||.|:|||.||:.||
  Fly    76 EDGTFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIR 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP4A1NP_001372194.1 PTP_DSP_cys 1..135 CDD:421693 74/129 (57%)
Interaction with ATF5. /evidence=ECO:0000250 97..132 28/34 (82%)
Phosphate binding 105..110 4/4 (100%)
PRL-1NP_001260487.1 PTP-IVa 10..163 CDD:350350 74/129 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4796
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2587
Inparanoid 1 1.050 206 1.000 Inparanoid score I3714
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54094
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001421
OrthoInspector 1 1.000 - - otm41940
orthoMCL 1 0.900 - - OOG6_101823
Panther 1 1.100 - - O PTHR23339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5007
SonicParanoid 1 1.000 - - X788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.