DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP4A1 and Ptp4a1

DIOPT Version :9

Sequence 1:NP_001372194.1 Gene:PTP4A1 / 7803 HGNCID:9634 Length:184 Species:Homo sapiens
Sequence 2:NP_035330.1 Gene:Ptp4a1 / 19243 MGIID:1277096 Length:173 Species:Mus musculus


Alignment Length:134 Identity:134/134 - (100%)
Similarity:134/134 - (100%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHV 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHV 65

Human    66 LDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAV 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    66 LDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAV 130

Human   131 QFIR 134
            ||||
Mouse   131 QFIR 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP4A1NP_001372194.1 PTP_DSP_cys 1..135 CDD:421693 134/134 (100%)
Interaction with ATF5. /evidence=ECO:0000250 97..132 34/34 (100%)
Phosphate binding 105..110 4/4 (100%)
Ptp4a1NP_035330.1 PTP-IVa1 1..167 CDD:350513 134/134 (100%)
Interaction with ATF5. /evidence=ECO:0000269|PubMed:11278933 97..132 34/34 (100%)
Phosphate binding. /evidence=ECO:0000250 105..110 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83952765
Domainoid 1 1.000 223 1.000 Domainoid score I22433
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2587
Inparanoid 1 1.050 360 1.000 Inparanoid score I14271
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG54094
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001421
OrthoInspector 1 1.000 - - oto116881
orthoMCL 1 0.900 - - OOG6_101823
Panther 1 1.100 - - LDO PTHR23339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5007
SonicParanoid 1 1.000 - - X788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1515.430

Return to query results.
Submit another query.