DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment f7 and flz

DIOPT Version :9

Sequence 1:NP_001072819.1 Gene:f7 / 780280 XenbaseID:XB-GENE-5787186 Length:452 Species:Xenopus tropicalis
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:308 Identity:109/308 - (35%)
Similarity:149/308 - (48%) Gaps:51/308 - (16%)


- Green bases have known domain annotations that are detailed below.


 Frog   166 DNSSTSRQCSCAEGYKLGADGLSCEPTVNY-------PCGKIPVLKNVNKRARIVGGDMCPKGEC 223
            |..:|......|.|.|:.:...:. ||.|.       .||..|.:|:    .|||||.....|..
  Fly  1401 DQGATLSSYGGANGRKIHSTSRTL-PTPNLAFHSPSTECGVRPHVKS----GRIVGGKGSTFGAY 1460

 Frog   224 PWQALLMYNE---IFI---CGGTLIAPNWVITAAHCLKPLPENKLTVVLGEHRI-GTPEGTEQES 281
            |||.|:..:.   :|.   |||.||...:||||||| :|.....|..|:||..| |..|.....:
  Fly  1461 PWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC-QPGFLASLVAVMGEFDISGDLESKRSVT 1524

 Frog   282 K-VSKIIMHEHYYGSKTNNDNDIALLKLTTPVNYTDYVVPLCLPEKQFAVQELLSIRYSTVSGWG 345
            | |.::|:|..|  .....:||:|||:|.:||.:..::||:|:|..   |.:... |.:||:|||
  Fly  1525 KNVKRVIVHRQY--DPATFENDLALLELDSPVQFDTHIVPICMPND---VADFTG-RMATVTGWG 1583

 Frog   346 RLLESGATPELLQRVQLPRVKTQDCIRQTQMNISQNMF--------------CAGYTDGSKDSCK 396
            ||...|..|.:||.||:|.::...|         |.||              ||||.:|.||||:
  Fly  1584 RLKYGGGVPSVLQEVQVPIIENSVC---------QEMFHTAGHNKKILTSFLCAGYANGQKDSCE 1639

 Frog   397 GDSGGPHATQYKNTHF-LTGIVSWGLGCAKKEKYGVYTRVSRYTEWIK 443
            ||||||...|..:..: |.|.||.|:.||.....|||.|.:.|..|::
  Fly  1640 GDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLR 1687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
f7NP_001072819.1 Gla 67..107 CDD:366184
EGF_CA 108..144 CDD:238011
FXa_inhibition 153..189 CDD:373209 5/22 (23%)
Tryp_SPc 212..445 CDD:238113 96/255 (38%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 96/255 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.