DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acbd7 and anox

DIOPT Version :10

Sequence 1:NP_001165067.1 Gene:acbd7 / 779685 XenbaseID:XB-GENE-5740466 Length:88 Species:Xenopus tropicalis
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:76 Identity:30/76 - (39%)
Similarity:38/76 - (50%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


 Frog     7 FDKAAEDVKKLKTRPTDEELKELYGLYKQSTVGDINIDCPGMLDLKAKAKWDAWNLKKGLSKEEA 71
            |..|.|.|.|........:|...||.|||:|.|......||:|.|:||:||.||.....:|:..|
  Fly    13 FHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAA 77

 Frog    72 MHAYISKTNEL 82
            ..||:.|..||
  Fly    78 RQAYVQKLQEL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acbd7NP_001165067.1 ACBP 4..87 CDD:238248 30/76 (39%)
anoxNP_001027085.1 ACBP 10..85 CDD:459982 27/71 (38%)
ANKYR <121..>231 CDD:440430
ANK repeat 148..179 CDD:293786
ANK repeat 181..212 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.