DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP3K12 and ark1

DIOPT Version :9

Sequence 1:NP_001180440.1 Gene:MAP3K12 / 7786 HGNCID:6851 Length:892 Species:Homo sapiens
Sequence 2:NP_001018849.1 Gene:ark1 / 3361036 PomBaseID:SPCC320.13c Length:355 Species:Schizosaccharomyces pombe


Alignment Length:334 Identity:82/334 - (24%)
Similarity:142/334 - (42%) Gaps:68/334 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    76 FANSVLQLHEQDAGGPGGAAGSPESRASRVRADEVRLQCQSGSGFLEGLFGCLRPVWTMIGKAYS 140
            |.:|:.::.|..||.|..|  .|:.|...:                 |:|        .|||.  
pombe    59 FNSSLRKIEEPIAGVPSSA--GPQWREFHI-----------------GMF--------EIGKP-- 94

Human   141 TEHKQQQEDLWEVPFEEILDLQWVGSGAQGAVFLGR------------FHGEEVAVKKVRDLKET 193
                                   :|.|..|.|:|.:            .|..|:...|:......
pombe    95 -----------------------LGKGKFGRVYLAKEKKTGFIVALKTLHKSELVQSKIEKQVRR 136

Human   194 DIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMN 258
            :|:....|:|.||:...|.........:::||..:|:||:.||..:..:..:...:...:|..::
pombe   137 EIEIQSNLRHKNILRLYGHFHDEKRIYLILEFAGRGELYQHLRRAKRFSEEVASKYIFQMANALS 201

Human   259 YLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEK 323
            |||...:||||:|..|:|:..|..:|:||||.|.. :..:.:.:..||:.::.||::..:..:||
pombe   202 YLHKKHVIHRDIKPENILLGIDGEIKLSDFGWSVH-APSNRRTTLCGTLDYLPPEMVEGKEHTEK 265

Human   324 VDIWSFGVVLWELLTGEIPYKDVDS-SAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNR 387
            ||:||.||:.:|.|.|..|::|:.. ||....:.  .:.|.:||..|...:.|:.:.....|..|
pombe   266 VDLWSLGVLTYEFLVGAPPFEDMSGHSATYKRIA--KVDLKIPSFVPPDARDLISRLLQHNPEKR 328

Human   388 PSFRQILLH 396
            .|..|::.|
pombe   329 MSLEQVMRH 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP3K12NP_001180440.1 STKc_MAP3K12_13 164..400 CDD:270961 68/246 (28%)
TyrKc 165..397 CDD:197581 68/245 (28%)
ark1NP_001018849.1 STKc_Aurora 89..341 CDD:270909 72/285 (25%)
S_TKc 89..340 CDD:214567 72/285 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.