DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rps6ka1 and S6k

DIOPT Version :9

Sequence 1:NP_001071243.1 Gene:rps6ka1 / 777728 ZFINID:ZDB-GENE-060929-516 Length:310 Species:Danio rerio
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:247 Identity:77/247 - (31%)
Similarity:121/247 - (48%) Gaps:25/247 - (10%)


- Green bases have known domain annotations that are detailed below.


Zfish    16 NTEYAVKVIDKTS-------TDPTEEIEILLRYGQHPNIITLKDVYDNGKQVYLVTELMRGGELL 73
            |..:|:||:.|.|       |..|.....:|...:||.|:.|...:....::||:.|.:.||||.
  Fly   103 NKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELF 167

Zfish    74 DRILKQKFFSEREASAVLHTITKTVEYLHSQGVVHRDLKPSNILYVDESGNPESLRICDFGFAKQ 138
            ..:.::..|.|......|..|...:.:||..|:::|||||.||| :|..|:   :::.|||..|:
  Fly   168 MHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENIL-LDAQGH---VKLTDFGLCKE 228

Zfish   139 LRADNGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGVLLYTMIAGFTPF-ANGPEDTPEEILS 202
            ...:..:..|.|.|..::|||:|.|.|:.:..|.||||.|::.|:.|..|| |...:.|.|.|| 
  Fly   229 HIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETIL- 292

Zfish   203 RIGSGRFTLTGGNWDAVSDAAKDLVSKMLHVDPHQRL-----TARQVLKHPW 249
               ..:..|..    .::..|:|||.:::.....|||     .|..|..||:
  Fly   293 ---KAKLNLPA----YLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rps6ka1NP_001071243.1 PKc_like 1..281 CDD:304357 77/247 (31%)
S_TKc 2..250 CDD:214567 77/247 (31%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 77/247 (31%)
STKc_p70S6K 81..402 CDD:270736 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.