DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF112 and gbp4

DIOPT Version :9

Sequence 1:XP_006721634.1 Gene:RNF112 / 7732 HGNCID:12968 Length:639 Species:Homo sapiens
Sequence 2:NP_001038355.1 Gene:gbp4 / 559296 ZFINID:ZDB-GENE-060531-46 Length:618 Species:Danio rerio


Alignment Length:172 Identity:48/172 - (27%)
Similarity:73/172 - (42%) Gaps:36/172 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   135 EPLLLVRINASGGLILRMGAINRCLKHPLARDTPVCLLAVLGEQHSGKSFLLNHLLQGLPGLESG 199
            :|:.|:...:.|.|.::..|: :.|:.   ...||.::||:|...:|||||:|.|.....|....
Zfish     3 KPVCLIDTGSDGKLCVQQAAL-QVLQQ---IQQPVVVVAVVGPYRTGKSFLMNRLAGKRTGFALS 63

Human   200 EGGRPRGGEASLQGCRWGANGLARGIWMW--SHPFLLGKEGKKVAVFLVDT---GDAMSPELSRE 259
            ...:|:                ..|||||  .||...|     ..:.|:||   ||....:..|:
Zfish    64 SNIKPK----------------TEGIWMWCVPHPTKAG-----TTLVLLDTEGLGDVEKGDSKRD 107

Human   260 TRIKLCALTTMLSS---YQILSTSQELKDTDLDYL-EMFVHV 297
            |.|  .:||.:|||   |....|...|....|.|: |:..|:
Zfish   108 TYI--FSLTVLLSSTLVYNSWGTIDNLAIEQLQYVTELIEHI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF112XP_006721634.1 RING 56..101 CDD:238093
GBP 163..402 CDD:206650 42/144 (29%)
gbp4NP_001038355.1 P-loop_NTPase 40..272 CDD:304359 38/131 (29%)
GBP_C 280..>402 CDD:303769
CARD_ASC_NALP1 532..614 CDD:260039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.