DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF154 and CG17359

DIOPT Version :9

Sequence 1:NP_001078853.1 Gene:ZNF154 / 7710 HGNCID:12939 Length:437 Species:Homo sapiens
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:343 Identity:97/343 - (28%)
Similarity:139/343 - (40%) Gaps:107/343 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   138 HTKAFSGKHTLVQQQRTLTT--ERC-------------YICSECGKSFSKSYSLNDHWR------ 181
            :|:.::..:.:.:|:..|.|  ..|             :||.||.::...:|.|....|      
  Fly    21 YTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAEAVRNAYRLRRQCRKSHQYF 85

Human   182 ----------------LHTGEK-----PYECRECGKSFRQSSSLI-------------------- 205
                            |:.|:.     |....|.||:...|..|:                    
  Fly    86 EQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPISSPL 150

Human   206 ----QHRRVHT---AVRPHECDECGKLFSNKSNLIKHRRVHTGERPYECSECGKSFSQRSALLQH 263
                :|:...:   |..||          |||.    ||.    |.|..::   |:|..|. |:|
  Fly   151 PDNNEHKLAQSYSPAKTPH----------NKSK----RRA----RSYSDND---SWSPDSE-LEH 193

Human   264 RGVHTGERPYECSECGKFFTYHSSLIKHQKVHSGSRPYECSECGKSFSQNSSLIEHHRVHTGERP 328
               ...::.:..|:.||           .|...|  ||.|..|.:||:|..:|..|.|:||||||
  Fly   194 ---EDDDKIWNASKRGK-----------PKRVPG--PYRCKLCTQSFTQKQNLEIHMRIHTGERP 242

Human   329 YKCSECGKSFSQRSALLQHRGVHTGERPYECSECGKFFPYSSSLRKHQRVHTGSRPYECSECGKS 393
            ||||.|.:||:|:..|..|...||||||:.|..|.|.|.....|:.|.|.|||.:|::||:|.:|
  Fly   243 YKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQS 307

Human   394 FTQNSGLIKHRRVHTGEK 411
            |.|.:||.||...||..|
  Fly   308 FKQLNGLQKHMSAHTRGK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF154NP_001078853.1 KRAB 14..>62 CDD:214630
KRAB 14..53 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..129
C2H2 Zn finger 135..155 CDD:275368 2/16 (13%)
COG5048 139..>436 CDD:227381 97/342 (28%)
C2H2 Zn finger 163..183 CDD:275368 6/41 (15%)
C2H2 Zn finger 191..211 CDD:275368 6/43 (14%)
C2H2 Zn finger 219..239 CDD:275368 5/19 (26%)
zf-H2C2_2 231..256 CDD:290200 5/24 (21%)
C2H2 Zn finger 247..267 CDD:275368 5/19 (26%)
C2H2 Zn finger 275..295 CDD:275368 4/19 (21%)
zf-H2C2_2 287..312 CDD:290200 8/24 (33%)
C2H2 Zn finger 303..323 CDD:275368 8/19 (42%)
zf-H2C2_2 315..340 CDD:290200 16/24 (67%)
C2H2 Zn finger 331..351 CDD:275368 8/19 (42%)
C2H2 Zn finger 359..379 CDD:275368 7/19 (37%)
zf-H2C2_2 371..396 CDD:290200 12/24 (50%)
C2H2 Zn finger 387..407 CDD:275368 10/19 (53%)
zf-H2C2_2 400..424 CDD:290200 6/12 (50%)
C2H2 Zn finger 415..435 CDD:275368
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 12/66 (18%)
zf-C2H2 215..237 CDD:278523 9/21 (43%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 229..254 CDD:290200 16/24 (67%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.