Sequence 1: | NP_001078853.1 | Gene: | ZNF154 / 7710 | HGNCID: | 12939 | Length: | 437 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
Alignment Length: | 343 | Identity: | 97/343 - (28%) |
---|---|---|---|
Similarity: | 139/343 - (40%) | Gaps: | 107/343 - (31%) |
- Green bases have known domain annotations that are detailed below.
Human 138 HTKAFSGKHTLVQQQRTLTT--ERC-------------YICSECGKSFSKSYSLNDHWR------ 181
Human 182 ----------------LHTGEK-----PYECRECGKSFRQSSSLI-------------------- 205
Human 206 ----QHRRVHT---AVRPHECDECGKLFSNKSNLIKHRRVHTGERPYECSECGKSFSQRSALLQH 263
Human 264 RGVHTGERPYECSECGKFFTYHSSLIKHQKVHSGSRPYECSECGKSFSQNSSLIEHHRVHTGERP 328
Human 329 YKCSECGKSFSQRSALLQHRGVHTGERPYECSECGKFFPYSSSLRKHQRVHTGSRPYECSECGKS 393
Human 394 FTQNSGLIKHRRVHTGEK 411 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZNF154 | NP_001078853.1 | KRAB | 14..>62 | CDD:214630 | |
KRAB | 14..53 | CDD:279668 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 110..129 | ||||
C2H2 Zn finger | 135..155 | CDD:275368 | 2/16 (13%) | ||
COG5048 | 139..>436 | CDD:227381 | 97/342 (28%) | ||
C2H2 Zn finger | 163..183 | CDD:275368 | 6/41 (15%) | ||
C2H2 Zn finger | 191..211 | CDD:275368 | 6/43 (14%) | ||
C2H2 Zn finger | 219..239 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 5/24 (21%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 275..295 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 287..312 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 303..323 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 315..340 | CDD:290200 | 16/24 (67%) | ||
C2H2 Zn finger | 331..351 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 359..379 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 371..396 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 387..407 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 400..424 | CDD:290200 | 6/12 (50%) | ||
C2H2 Zn finger | 415..435 | CDD:275368 | |||
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | 12/66 (18%) |
zf-C2H2 | 215..237 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 16/24 (67%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 10/19 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |