DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIM25 and brat

DIOPT Version :9

Sequence 1:NP_005073.2 Gene:TRIM25 / 7706 HGNCID:12932 Length:630 Species:Homo sapiens
Sequence 2:NP_001188842.2 Gene:brat / 35197 FlyBaseID:FBgn0010300 Length:1061 Species:Drosophila melanogaster


Alignment Length:397 Identity:78/397 - (19%)
Similarity:128/397 - (32%) Gaps:120/397 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    29 GHNFCGSCLNETWAVQGSPYLCPQCRA--------VYQARPQLHKNTVLCNVVEQFL------QA 79
            |.|...:..:...:..|||..|..|::        .::.:..|..|   |....:|:      ..
  Fly   158 GSNSSSNSSSSNTSANGSPPRCTACKSKCSDAVAKCFECQSYLCAN---CVTAHEFMHCFNGHNV 219

Human    80 DLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCL------------------------ 120
            .|.:...|.....|....:||.|   ...:..|.|:..|.:                        
  Fly   220 CLIKGFEASTTGTPLSVGSPSNN---PASNEFKYASSLTMMLQQQQQLDSQQQQQQQQLLPAQPM 281

Human   121 -----VCMASFCQEHL--QPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSE----- 173
                 :.:|:..|.:.  |...||.....||.|        ::..|..:.|:.|||.|.:     
  Fly   282 SQLSKIVLAAAAQANSQEQQREDSIYGSLHPQQ--------QQQQQQQQQRQLFCPRHKQELLKF 338

Human   174 -----CI--CHICLV-EHK--------------TCSPASLSQASA--DLEATLRHKLTVMYSQIN 214
                 ||  |..|:| ||.              |.|..|.:..||  .|.|.:|.|:..:.....
  Fly   339 SCRTCCILVCKECIVLEHSTGLHELENVQSPGMTTSTGSTANESALQTLLADMRGKIGEIVGIAG 403

Human   215 GASRALDDVRNRQQDVRMTANRKVEQLQQEYTEM-----KALLDASETTSTRKIKEE---EKRVN 271
            .:.:.|..|:.:.|    .|:.::.:..|.:..|     ..||...||..|.|:...   ::|..
  Fly   404 NSDQNLTKVKLQYQ----KAHNELNETHQFFASMLDERKTELLKELETLYTAKVNSNNSWQQRSR 464

Human   272 SKFD------------------TIYQILLKKKSEIQTLKEEIEQSLTKRDEFEFLEKASKLR-GI 317
            ...|                  .:.:.||.:||..|.|:..| |.:....|.||:.....:: |:
  Fly   465 DLIDKGLATCEAVERSPAPPSSLLTEALLLRKSLEQQLQTGI-QEMQLPFEIEFMSNYQSIQAGV 528

Human   318 STKPVYI 324
            .....||
  Fly   529 RNTFGYI 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIM25NP_005073.2 RING 13..53 CDD:302633 6/23 (26%)
Interaction with influenza A virus NS1 180..450 40/189 (21%)
HR1 180..252 CDD:294066 18/93 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..403
SPRY_PRY_TRIM25 459..627 CDD:293971
bratNP_001188842.2 BBOX 176..222 CDD:197662 7/48 (15%)
zf-B_box 328..366 CDD:279037 10/37 (27%)
NHL_brat_like 760..1030 CDD:271329
NHL repeat 783..819 CDD:271329
NHL repeat 830..871 CDD:271329
NHL repeat 874..910 CDD:271329
NHL repeat 914..954 CDD:271329
NHL repeat 959..997 CDD:271329
NHL repeat 1002..1027 CDD:271329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2677
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.