DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF141 and Meics

DIOPT Version :9

Sequence 1:XP_016864080.1 Gene:ZNF141 / 7700 HGNCID:12926 Length:534 Species:Homo sapiens
Sequence 2:NP_524062.1 Gene:Meics / 39539 FlyBaseID:FBgn0025874 Length:583 Species:Drosophila melanogaster


Alignment Length:336 Identity:118/336 - (35%)
Similarity:175/336 - (52%) Gaps:37/336 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   235 ECGKSF--QK--FSHLTQHKVIHAGEKPYTCEECGKAFKWSLIFNEHKRIHTGEKPFTCEECGSI 295
            |||.|:  ||  ..|:.:||.....:||:.|:.||:.|:.:.....|:|.||||:||.|..|...
  Fly   244 ECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKA 308

Human   296 FTTSSHFAKHKIIHTGEKPYKCEECGKAFNRFTTLTKHKRIHAGEKPITCEECRKIFTSSSNFAK 360
            :|.......|...|..||.:||.:|.|.|.....|..|.:.|.||:|..|.:|.:.|..:|....
  Fly   309 YTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKL 373

Human   361 HKRIHTGEKPYKCEECGKAFNRSTTLTKHKRIHTGEKPYTCEECGKAFRQSSKLNEHKKVHTGER 425
            |.|:|..|:|:|||.|||.|.::..|..|.|:|.|::.:.|.:|.|:|.:.|.:.:|::.|:|.:
  Fly   374 HSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIK 438

Human   426 PYKCDECGKAFGRSRVLNEHKKIHTGEKPYKCEECGKAFRRSTDRSQHKKIH--SADKPYKCKEC 488
            |:||:|||:||..:..|..|.:||||||||||::|||.|..:....:|...|  :.|:|:||.:|
  Fly   439 PFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQC 503

Human   489 DKAFKQFSLLSQHKKIH-----------------------TVDK--------PYKCKDCDKAFKR 522
            .||:.....|..|:|.|                       |:||        |:.|..|.:.|..
  Fly   504 PKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFS 568

Human   523 FSHLNKHKKIH 533
            ...|.||.::|
  Fly   569 QKSLKKHLRLH 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF141XP_016864080.1 None
MeicsNP_524062.1 zf-AD 21..95 CDD:285071
C2H2 Zn finger 242..262 CDD:275368 7/17 (41%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 10/23 (43%)
C2H2 Zn finger 302..322 CDD:275368 4/19 (21%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 342..366 CDD:290200 8/23 (35%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
C2H2 Zn finger 386..406 CDD:275368 9/19 (47%)
COG5048 <395..583 CDD:227381 61/185 (33%)
zf-C2H2 412..434 CDD:278523 6/21 (29%)
C2H2 Zn finger 414..434 CDD:275368 6/19 (32%)
zf-H2C2_2 426..451 CDD:290200 11/24 (46%)
C2H2 Zn finger 442..462 CDD:275368 8/19 (42%)
zf-H2C2_2 454..478 CDD:290200 15/23 (65%)
C2H2 Zn finger 470..486 CDD:275368 5/15 (33%)
C2H2 Zn finger 500..520 CDD:275368 7/19 (37%)
C2H2 Zn finger 532..552 CDD:275370 3/19 (16%)
C2H2 Zn finger 559..579 CDD:275370 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3084
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.