DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF131 and kel-20

DIOPT Version :9

Sequence 1:NP_001284477.1 Gene:ZNF131 / 7690 HGNCID:12915 Length:623 Species:Homo sapiens
Sequence 2:NP_491322.2 Gene:kel-20 / 172012 WormBaseID:WBGene00020030 Length:607 Species:Caenorhabditis elegans


Alignment Length:178 Identity:44/178 - (24%)
Similarity:69/178 - (38%) Gaps:36/178 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    20 ILDRLNEQREQDRFTDITLIVDGHHFKAHKAVLAACSKFFYKFFQE-----FTQEPLVEIEGVSK 79
            :|.:|...:.:|...|:|||.......||:.||:|||.:|...|..     :.:|  :.:|.:..
 Worm    42 VLQQLGGLKNRDVLCDVTLICGWKRINAHRVVLSACSPYFLSMFTSQMAECYMRE--INMEEIEP 104

Human    80 MAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEA--------IKALEVRN----------- 125
            .....||||.||..:.|. :....|:..||..||:.|.        .|.|:..|           
 Worm   105 PTLEALIEFCYTGAIAID-DSNVQDILPAACLLQIHEVQTACCDYLKKQLDPSNCLGIRAFADTH 168

Human   126 --KENSAPLEE-------NTTGKNEAKKRKIAETSNVITESLPSAESE 164
              ||..:..:|       ...||.|.:...:...:.:|.....:|.||
 Worm   169 SCKELLSSADEFALKNFSRVIGKEEFQMLTVESLTTIIKSDKLNAASE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF131NP_001284477.1 BTB 24..122 CDD:279045 31/110 (28%)
BTB 35..122 CDD:197585 29/99 (29%)
Nuclear localization signal 1. /evidence=ECO:0000269|PubMed:17306895 137..148 3/10 (30%)
COG5048 <262..444 CDD:227381
C2H2 Zn finger 263..283 CDD:275368
C2H2 Zn finger 290..311 CDD:275368
Nuclear localization signal 2. /evidence=ECO:0000269|PubMed:17306895 317..328
C2H2 Zn finger 330..350 CDD:275368
zf-H2C2_2 342..367 CDD:290200
C2H2 Zn finger 358..375 CDD:275368
C2H2 Zn finger 394..414 CDD:275368
C2H2 Zn finger 422..439 CDD:275370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 573..623
kel-20NP_491322.2 PHA03098 56..572 CDD:222983 41/164 (25%)
KELCH repeat 345..389 CDD:276965
KELCH repeat 393..437 CDD:276965
KELCH repeat 440..485 CDD:276965
KELCH repeat 487..531 CDD:276965
KELCH repeat 534..577 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.