DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:ch211-195b13.1 and S6k

DIOPT Version :9

Sequence 1:NP_001070770.2 Gene:si:ch211-195b13.1 / 768159 ZFINID:ZDB-GENE-030131-7626 Length:423 Species:Danio rerio
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:382 Identity:162/382 - (42%)
Similarity:230/382 - (60%) Gaps:39/382 - (10%)


- Green bases have known domain annotations that are detailed below.


Zfish    65 ELD----ENLLCLTHPRSSLAEET-------------QIKPSDFDYLKIIGKGSFGKVLLARH-- 110
            |||    |..||:...:.:..:||             ::.|.||:..|::|||.:|||...|.  
  Fly    34 ELDDVDLEPELCINLHQDTEGQETIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRKTA 98

Zfish   111 -KENELYYAVKVLQK-KIIMKKKEQKHIMAERSVLMKNIKHPFLVGLHYSFQTTDKLYFVLDYVN 173
             ::...|:|:|||:| .|:..:|:..|..|||::| :.:||||:|.|.|:|||..|||.:|:|::
  Fly    99 GRDANKYFAMKVLKKASIVTNQKDTAHTRAERNIL-EAVKHPFIVELVYAFQTDGKLYLILEYLS 162

Zfish   174 GGELFYHLQRERVFLEPRARFYAAEIASALGYLHSLHIVYRDLKPENILLDSQGHIVLTDFGLCK 238
            |||||.||:||.:|||....||.:||..|||:||.|.|:||||||||||||:|||:.||||||||
  Fly   163 GGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCK 227

Zfish   239 EGLDPNGTTTTFCGTPEYLAPEVLQKQAYDRTVDWWCLGSVLFEMLYGLPPFYSRNTAEMYNNIL 303
            |.:.....|.|||||.||:|||:|.:..:.:.||||.||:::|:||.|:|||.:.|..:....||
  Fly   228 EHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETIL 292

Zfish   304 HKPLVLKPNVSNAGRDLLEGLLHKDRTKRLGS-KDDFLELKFHSFFSPINWDDLMAKRIVPPFIP 367
            ...|.|...::...|||:..|:.:...:|||| .:|...::.|.||..:||||::|:|:.||..|
  Fly   293 KAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKP 357

Zfish   368 TVTGPTDLRHFDPEFT-HLPV----STSLCNTDNLHVTSSVREAAGAFPGFSYGPPS 419
            .:....|:..||..|| .:||    .|:|..:.||           .|.||:|..||
  Fly   358 LLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANL-----------IFQGFTYVAPS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:ch211-195b13.1NP_001070770.2 S_TKc 91..348 CDD:214567 124/261 (48%)
STKc_SGK 95..415 CDD:270727 148/329 (45%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 148/332 (45%)
STKc_p70S6K 81..402 CDD:270736 149/332 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.