DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment khdrbs2 and how

DIOPT Version :9

Sequence 1:NP_001070758.1 Gene:khdrbs2 / 768147 ZFINID:ZDB-GENE-061013-497 Length:346 Species:Danio rerio
Sequence 2:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster


Alignment Length:381 Identity:112/381 - (29%)
Similarity:175/381 - (45%) Gaps:97/381 - (25%)


- Green bases have known domain annotations that are detailed below.


Zfish     6 YLPELVAEKESLDA---SFVHAMRLLAEEIEKFEGDELRKDGEVKKYLDIISNKN--IKLSERVL 65
            ||.:|:.:::.|.|   .|.|..|||.|||.:......:.:|..|:.|.:...:.  :.::|:|.
  Fly    78 YLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQINGVKKEPLTLPEPEGSVVTMNEKVY 142

Zfish    66 IPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLSND 130
            :||:::|.|||||::|||||.:.|:|::|||.|:.:.||||||||.||:..|  |:..:.|||:|
  Fly   143 VPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANR--GKPNWEHLSDD 205

Zfish   131 LHVLIEVFAPPGEAYSRMSHALEEIKKFLVP--DYNDEIRQEQLRELSYLNGS------------ 181
            |||||.|......|..:::.|:.|::|.|||  :..||:::.||.||:.:||:            
  Fly   206 LHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDTTAKSVAAF 270

Zfish   182 --------------DDPSRGRSARGRGLRLTSTASPRGRGSAAPPAPPGRGAAAPRGT---VSSR 229
                          |:..|...|......||||..|   |.||....|   ||||.|.   ::.|
  Fly   271 SCVGSASYLYPAVCDEEWRRLVAASDSRLLTSTGLP---GLAAQIRAP---AAAPLGAPLILNPR 329

Zfish   230 TSVPTPARGVSAPRTRGTAGTPGYRAPSLQATHKTYEDYGYDDGYDGEYDDQSYESYDDN----- 289
            .:|||.|..:.:.:...||               .::..|:...: ..||..:|.:...|     
  Fly   330 MTVPTTAASILSAQAAPTA---------------AFDQTGHGMIF-APYDYANYAALAGNPLLTE 378

Zfish   290 YSNQSKSVSEYYEYGHGNNDENYNNYEEDWISSRPNLKAPASRLTRGGYRDHPYGR 345
            |::.|.::.:                              ..||...  |:|||.|
  Fly   379 YADHSGAIKQ------------------------------QRRLATN--REHPYQR 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
khdrbs2NP_001070758.1 Qua1 6..57 CDD:292891 16/53 (30%)
SF1_like-KH 61..180 CDD:239088 56/120 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..292 33/150 (22%)
Sam68-YY <281..>306 CDD:293176 4/29 (14%)
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 14/44 (32%)
SF1_like-KH 139..260 CDD:239088 58/122 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.