DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gtf2a1l and stnB

DIOPT Version :9

Sequence 1:NP_001070039.1 Gene:gtf2a1l / 767629 ZFINID:ZDB-GENE-060929-28 Length:376 Species:Danio rerio
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:366 Identity:80/366 - (21%)
Similarity:114/366 - (31%) Gaps:121/366 - (33%)


- Green bases have known domain annotations that are detailed below.


Zfish    60 DNNPSKFVLQLPANYTQS------LHKPTVVIPAAANVQNFTSKTSCGSVATFSLPPGITYPVQI 118
            |...|:.:.::||..:.|      ||.|:.           |..:....:...|:..|.:...| 
  Fly   140 DETSSELLGRIPATRSPSPVSMRDLHSPSP-----------TPDSGLADLLDVSVDSGSSAHTQ- 192

Zfish   119 PAGVTLQTASGHLYKVNVPVMVTRGAQHVLTRPAQAPVTLPQLPARLPDPAAPAYLPNSTAP--A 181
              |:.....||          |..|.:  |..|...|..:|.:.|.:|.||.|...|....|  .
  Fly   193 --GIEADLISG----------VAGGVR--LDNPFAVPTAVPNIQAAVPLPATPIKQPPRPPPPRP 243

Zfish   182 CPPDPAPP---ALQTPPEPSSA-----SASPGEFTLDGI------EFSPQPVDASS--------- 223
            .||.||||   |.|.||.|.:|     :|...:..||..      ...|.|..:..         
  Fly   244 APPRPAPPGQAAPQRPPPPLAAVNPPPAAPEADDLLDMFGTTACKPAKPPPPKSKEDILSLFEQP 308

Zfish   224 HTPA---------------QHCGYSSFPKERDADPPDLQNNTSPGQQLSFSPLL--------DI- 264
            |.|.               :..|....|::.:.| .:..|..|...:..|:.||        || 
  Fly   309 HVPLSQPASKPDLLHDDLDETIGEGEPPEQEEPD-TEQSNEISSRDEPVFTSLLIRPDESTHDIT 372

Zfish   265 --PQL--------------DGAADS-------------SDSLEEEDEDEEELGLVGEKEFLGMIS 300
              ||.              .|.|.:             .|....:||||.|.....|.|....|.
  Fly   373 SQPQAATGLERQVNNMAAPSGTASTQRATTPDIEITTVEDLPRSDDEDEPEAMQEPETETKPQIE 437

Zfish   301 ANEEEELEEEEDP----------LNSGDDVSEQDIPEIFDT 331
            .:.|.|:..|..|          |..|:.::.:..||..||
  Fly   438 PDTEPEIVSEHSPPTERLVTQAALVDGELIAAEPEPEEMDT 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtf2a1lNP_001070039.1 TFIIA_alpha_beta_like 8..>68 CDD:199899 2/7 (29%)
TFIIA 11..376 CDD:281188 80/366 (22%)
TFIIA_alpha_beta_like <319..376 CDD:199899 4/13 (31%)
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603 21/102 (21%)
AP_MHD_Cterm 897..1219 CDD:299401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1533
SonicParanoid 1 1.000 - - X2217
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.