DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF121 and pita

DIOPT Version :9

Sequence 1:NP_001008727.1 Gene:ZNF121 / 7675 HGNCID:12904 Length:390 Species:Homo sapiens
Sequence 2:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster


Alignment Length:232 Identity:78/232 - (33%)
Similarity:123/232 - (53%) Gaps:6/232 - (2%)


- Green bases have known domain annotations that are detailed below.


Human   165 THTGEK----PYECKECGKCFTVSSHLVEHVRIHTGEKPYQCKECGRAFAGRSGLTKHVRIHTGE 225
            |...||    .:.|.:|.:.|.:...|..|...||..:.:||..|.::|..:..|.||..:||||
  Fly   275 TKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTGE 339

Human   226 KPYECNECGKAYNRFYLLTEHFKTHTEEKPFECKVCGKSFRSSSCLKNHFRIHTGIKPYKCKECG 290
            :|::|..|.||:.|..||..|.:|||:...|.|..|.|.|.|...::.|...|...:|::|..|.
  Fly   340 RPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCT 404

Human   291 KAFTVSSSLHNHVKIHTGEKPYECKDCGKAFATSSQLIEHIRTHTGEKPYICKECGKTFRASSHL 355
            |:|.....|..|..:|:...|:.|:.|.::|:|:|:|..|:..|.|::.|.||.|.|::..|.||
  Fly   405 KSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHL 469

Human   356 QKHVRIH--TGEKPYICNECGKAYNRFYLLTKHLKTH 390
            .:|:|.|  |.:..::|:||..:|:.:..|..|...|
  Fly   470 SRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHALIH 506

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ZNF121NP_001008727.1 C2H2 Zn finger 65..82 CDD:275368
COG5048 <85..270 CDD:227381 39/108 (36%)
C2H2 Zn finger 91..110 CDD:275368
C2H2 Zn finger 119..138 CDD:275368