| Sequence 1: | NP_005172.1 | Gene: | CA3 / 761 | HGNCID: | 1374 | Length: | 260 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_572581.1 | Gene: | CARPB / 31915 | FlyBaseID: | FBgn0052698 | Length: | 327 | Species: | Drosophila melanogaster |
| Alignment Length: | 53 | Identity: | 10/53 - (18%) |
|---|---|---|---|
| Similarity: | 18/53 - (33%) | Gaps: | 18/53 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Human 489 SALIEHPAVVESAVVSSPDPIRGEVVKAFIVLAAPYKCSNREKLTAELQDHVK 541 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CA3 | NP_005172.1 | alpha_CA_I_II_III_XIII | 1..259 | CDD:239393 | |
| Involved in proton transfer. /evidence=ECO:0000269|PubMed:17427958 | 64..67 | ||||
| CARPB | NP_572581.1 | alpha_CARP_X_XI_like | 37..298 | CDD:239395 | 10/53 (19%) |
| Blue background indicates that the domain is not in the aligned region. | |||||