DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CA2 and CAH1

DIOPT Version :9

Sequence 1:NP_000058.1 Gene:CA2 / 760 HGNCID:1373 Length:260 Species:Homo sapiens
Sequence 2:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster


Alignment Length:273 Identity:125/273 - (45%)
Similarity:158/273 - (57%) Gaps:25/273 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLK--PLSVSYDQATSLRILNNG 63
            |||||||.:.|||.||.|::|.|.|.|||||||...:||....|.  ||...|....:..::|.|
  Fly     1 MSHHWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPG 65

Human    64 HAFNVEFDDSQDKAVLKGGPL-DGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWN-TK 126
            :.:.|:.:.:..:  |.|||| |..::|.|||.|||..|.:|||||||...|:.|||||||| ||
  Fly    66 YCWRVDVNGADSE--LTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTK 128

Human   127 YGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADF-TNFDPRGLLPESLDY 190
            |..||:|...||||||||:|||.|:....|.||..:|..:..||..... ...||..|||:...|
  Fly   129 YKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHTY 193

Human   191 WTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLN------------FNGEGEPEELMVDN 243
            |||.|||||||..|.|.|||.|.||.||.:|:...|.||            |||:      :::|
  Fly   194 WTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGK------VINN 252

Human   244 WRPAQPLKNRQIK 256
            :||..||..|:::
  Fly   253 FRPPLPLGKRELR 265

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CA2NP_000058.1 alpha_CA_I_II_III_XIII 1..259 CDD:239393 125/273 (46%)