DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MZF1 and CG17802

DIOPT Version :9

Sequence 1:XP_005259261.1 Gene:MZF1 / 7593 HGNCID:13108 Length:775 Species:Homo sapiens
Sequence 2:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster


Alignment Length:147 Identity:52/147 - (35%)
Similarity:76/147 - (51%) Gaps:5/147 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   573 RRVHSGERPFACAECGQSFRQRSNLTQHRRIHTGERPFACAECGKAFRQRPTLTQHLRV-HTGEK 636
            |:.:..::...|..||:.|..:.|...|...|:|.:||.|.|||:....|..|..|:|| |.|||
  Fly   271 RKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEK 335

Human   637 PFACPECGQRFSQRLKLTRHQ-RTHTGEKP---YHCGECGLGFTQVSRLTEHQRIHTGERPFACP 697
            |:||..|.:||......:||: |.|..:|.   :.|..|...:....:..:|:.:|||||.|.|.
  Fly   336 PYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCE 400

Human   698 ECGQSFRQHANLTQHRR 714
            .|..||.:::||..|.|
  Fly   401 VCKVSFTRNSNLKTHYR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MZF1XP_005259261.1 SCAN 81..193 CDD:128708
COG5048 399..757 CDD:227381 52/147 (35%)
C2H2 Zn finger 399..419 CDD:275368
C2H2 Zn finger 427..447 CDD:275368
C2H2 Zn finger 455..475 CDD:275368
C2H2 Zn finger 483..503 CDD:275370
C2H2 Zn finger 528..548 CDD:275368
C2H2 Zn finger 556..576 CDD:275368 1/2 (50%)
C2H2 Zn finger 584..604 CDD:275368 6/19 (32%)
C2H2 Zn finger 612..632 CDD:275368 9/20 (45%)
C2H2 Zn finger 640..660 CDD:275368 7/20 (35%)
C2H2 Zn finger 668..688 CDD:275368 3/19 (16%)
C2H2 Zn finger 696..716 CDD:275368 8/19 (42%)
C2H2 Zn finger 724..744 CDD:275368
C2H2 Zn finger 752..772 CDD:275368
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 9/20 (45%)
C2H2 Zn finger 339..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 371..388 CDD:275370 2/16 (13%)
zf-met 398..421 CDD:289631 8/20 (40%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.