DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ZNF41 and ube2c

DIOPT Version :9

Sequence 1:	NP_001311084.1	Gene:	ZNF41 / 7592	HGNCID:	13107	Length:	821	Species:	Homo sapiens
Sequence 2:	NP_001095283.1	Gene:	ube2c / 100124324	XenbaseID:	XB-GENE-971108	Length:	179	Species:	Xenopus tropicalis

Alignment Length:	92	Identity:	23/92 - (25%)
Similarity:	39/92 - (42%)	Gaps:	4/92 - (4%)

- Green bases have known domain annotations that are detailed below.

Human   208 GYEHKNIEKIIHVTTKLVPSIKRLHN-CDTILKHTLNSHNHNRNSATKNLGKIFGNGNN-FPHSP 270
            ||.: |...:..||....|::....| |..|||... |..::..:...:|..:.|..|| .|.:|
Frog    88 GYPY-NAPTVKFVTPCFHPNVDSHGNICLDILKDKW-SALYDVRTILLSLQSLLGEPNNESPLNP 150

Human   271 SSTKNENAKTGANSCEHDHYEKHLSHK 297
            .:.:....:|......|:.|:|.:..|
Frog   151 YAAELWQNQTAYKKHLHEQYQKQVREK 177

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ZNF41	NP_001311084.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..55
		KRAB	69..129	CDD:214630
		KRAB	69..108	CDD:279668
		C2H2 Zn finger	315..335	CDD:275368
		COG5048	346..768	CDD:227381
		C2H2 Zn finger	371..391	CDD:275368
		zf-H2C2_2	383..406	CDD:290200
		C2H2 Zn finger	399..419	CDD:275368
		zf-H2C2_2	411..436	CDD:290200
		C2H2 Zn finger	427..447	CDD:275368
		zf-H2C2_2	439..464	CDD:290200
		C2H2 Zn finger	455..475	CDD:275368
		zf-H2C2_2	467..492	CDD:290200
		C2H2 Zn finger	483..503	CDD:275368
		zf-H2C2_2	495..519	CDD:290200
		C2H2 Zn finger	511..531	CDD:275368
		zf-H2C2_2	526..548	CDD:290200
		C2H2 Zn finger	539..559	CDD:275368
		zf-H2C2_2	551..575	CDD:290200
		C2H2 Zn finger	567..587	CDD:275368
		zf-H2C2_2	579..602	CDD:290200
		C2H2 Zn finger	595..615	CDD:275368
		C2H2 Zn finger	623..643	CDD:275368
		zf-H2C2_2	636..660	CDD:290200
		C2H2 Zn finger	651..671	CDD:275368
		zf-C2H2	677..699	CDD:278523
		C2H2 Zn finger	679..699	CDD:275368
		C2H2 Zn finger	707..727	CDD:275368
		zf-H2C2_2	719..743	CDD:290200
		C2H2 Zn finger	735..755	CDD:275368
		C2H2 Zn finger	763..783	CDD:275368
		C2H2 Zn finger	791..811	CDD:275368
ube2c	NP_001095283.1	UQ_con	34..170	CDD:365926	20/83 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	45	1.000	Domainoid score	I41123
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
NCBI	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.910