DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt4 and GstE9

DIOPT Version :9

Sequence 1:NP_083748.3 Gene:Gstt4 / 75886 MGIID:1923136 Length:240 Species:Mus musculus
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:169 Identity:55/169 - (32%)
Similarity:86/169 - (50%) Gaps:10/169 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MG-LELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLK-DGKFI 63
            || |.||....|.|.||..:.....|:.::::.|:||.|.|.:||:...||...:|.|: |||||
  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65

Mouse    64 LSESVAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEV 128
            . ||.||..||.|:|:.....||.|...||.||:.:.::...:.....:.:.|.|....||  ||
  Fly    66 W-ESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNIT--EV 127

Mouse   129 PTERLEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLAD 167
            |..:::...:     ...|.|.|:.::.::.|..|::||
  Fly   128 PRSQIDAIYE-----AYDFLEAFIGNQAYLCGPVITIAD 161

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt4NP_083748.3 GstA 3..>170 CDD:223698 53/166 (32%)
GST_N_Theta 3..78 CDD:239348 31/75 (41%)