DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt4 and GstT2

DIOPT Version :9

Sequence 1:NP_083748.3 Gene:Gstt4 / 75886 MGIID:1923136 Length:240 Species:Mus musculus
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:202 Identity:62/202 - (30%)
Similarity:106/202 - (52%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLKDGKFILSES 67
            :..|.||||...|.::|..:.:..|.::..:.|.|....:.||.:||..:|:|::..|.|.|||:
  Fly     5 IRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSET 69

Mouse    68 VAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPM--ITGEEVPT 130
            :||:.||..|.......||..|..|||||||:.|||..|::..|.......:.||  |..:..| 
  Fly    70 IAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKP- 133

Mouse   131 ERLEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLADLVALVEMMQPMGSNHNVFVSS--KLAEW 193
            |:::..::.|:.||...|..:|::. |:.|.::::||::...|:.|.....:.|....  |:.:|
  Fly   134 EQIQALIEGVENNLGLLERLWLEND-FLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVKW 197

Mouse   194 RMRVELA 200
            ..||.::
  Fly   198 LERVRVS 204

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt4NP_083748.3 GstA 3..>170 CDD:223698 55/168 (33%)
GST_N_Theta 3..78 CDD:239348 25/74 (34%)