DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mff and Tango11

DIOPT Version :9

Sequence 1:XP_036010058.1 Gene:Mff / 75734 MGIID:1922984 Length:354 Species:Mus musculus
Sequence 2:NP_726111.1 Gene:Tango11 / 246596 FlyBaseID:FBgn0050404 Length:277 Species:Drosophila melanogaster


Alignment Length:340 Identity:81/340 - (23%)
Similarity:144/340 - (42%) Gaps:105/340 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse    36 EMEYTEGISQRMRVPEKLKVAP--PNADLEQEFQDGVPNA-----SVIMQVPERIVVTGNNEDI- 92
            :.:|...|:.:||||:::|...  .|.||....|:|:.::     .:.|.||:||||.|:|:.: 
  Fly    21 DAKYAHEINDKMRVPKRIKATGEYSNEDLLLSNQNGMISSWNYHDKIDMNVPDRIVVLGHNQHLE 85

Mouse    93 SFSRPADLDLIQS-TPFKP----LALKTPPRVLTLSERPLDFLDLERPLPTPQSEEQSRAVGRLK 152
            :.|.|.::.|..| .|..|    :.::||||::||:::..           |.:.|:|       
  Fly    86 TRSAPREIQLENSILPKNPSVGLVRVQTPPRIITLTDQHF-----------PSASEES------- 132

Mouse   153 RERSMSENAVRQNGQLVRNDSMWHRSDSAPRNKISRFQSLISAPEYTVTPSPPQARVCPPHMLPE 217
                   :.:|.||..:..:.:...:|...          :.|.:|.                  
  Fly   133 -------SPIRANGHHLYGNDLDEDADDEE----------VHATQYV------------------ 162

Mouse   218 DGANLSSARGILSLIQSSTRRAYQQILDVLDENRSVRRQNEIRYERPVLRGGSAAATS--NPHHD 280
                  .|.|:       .|..:|.     ::..||...::       |..|||:..|  |....
  Fly   163 ------RANGV-------ARMGFQG-----NDTNSVESDSQ-------LTTGSASKRSQLNQQQH 202

Mouse   281 NVRYGISNLDAAI----EGA-SDDMTV-VDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSI 339
            |      ||||::    ||. ..::|. .:...||||:.|||||:..:|..|::|.:||.::|.:
  Fly   203 N------NLDASMLAHREGTPMGELTPHEEILYLRRQLAKLNRRVLNIEINNEQRTQREKIVYCL 261

Mouse   340 TVAFWLLNSWLWFRR 354
            .:|:::|.:..|..|
  Fly   262 GLAYFVLKTIFWLNR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MffXP_036010058.1 Miff 27..354 CDD:398976 80/338 (24%)
Tango11NP_726111.1 Miff 15..276 CDD:283332 80/338 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841797
Domainoid 1 1.000 69 1.000 Domainoid score I9662
eggNOG 1 0.900 - - E1_2929X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5325
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007339
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107502
Panther 1 1.100 - - O PTHR16501
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5455
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.