DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF18 and znf143a

DIOPT Version :9

Sequence 1:NP_001290210.1 Gene:ZNF18 / 7566 HGNCID:12969 Length:549 Species:Homo sapiens
Sequence 2:NP_001007442.1 Gene:znf143a / 492800 ZFINID:ZDB-GENE-041114-154 Length:613 Species:Danio rerio


Alignment Length:455 Identity:118/455 - (25%)
Similarity:176/455 - (38%) Gaps:128/455 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   171 SSGPGELLSHIVKEESDTEAE-LALAASQPARLEERLIRDQD-----LGASLLPAAPQEQWRQLD 229
            |.|....:.|..::.|..|.: :.|.....|.::...:...|     :|:|:......|..| |:
Zfish    49 SDGSTAYIPHNPQDNSIVEGQVIQLEDGSSAYVQHIAVPKADEPNNWMGSSVCDVVGNESLR-LE 112

Human   230 STQKEQYWDLMLETYGKMVSGAGISHPKSDL-----TNSIEFGEELAGIYLHVNEKIPRPTCIGD 289
            ..|..|..|         .:.|.|.|...|:     ..:::. |:.:..|:....::.:|..|..
Zfish   113 DAQTVQLED---------GTTAYIHHTTKDVYEPSTLQAVQL-EDGSTAYIQHAVQVSQPNTILA 167

Human   290 RQEN------------DKENLN-----------LENHRDQELLHASCQASGEVPSQASLRGFFTE 331
            .|.|            |:|.:|           ::::.:.||:  |....|.|..|..|:|....
Zfish   168 IQANGTVADLHTDAAIDQETMNALEQYTTKIEEIDSYTNPELI--SNDPQGVVEMQIVLQGQGIR 230

Human   332 ---DEPG--CFGEGENLPEALQNIQDEGTGEQLSPQERISEKQLGQHLPNPHSGEMSTMWLEEKR 391
               ..||  ||           ....:|.|:..:         ...||.           :.|:.
Zfish   231 RNVQSPGEKCF-----------RCNYDGCGKLYT---------TANHLK-----------VHERA 264

Human   392 ETSQKGQPRAPMAQKLPTCRECGKTFYRNSQLIFHQRTHTGETYFQC--TICKKAFLRSSDFVKH 454
            .|..|     |....||   .|||.|.....|..|.||||||..::|  ..|||:|..|.|..||
Zfish   265 HTGDK-----PYCCDLP---GCGKKFATGYGLKSHIRTHTGEKPYRCQELDCKKSFKTSGDLQKH 321

Human   455 QRTHTGEKPCKCDY--CGKGFSDFSGLRHHEKIHTGEKPYKCPI--CEKSFIQRSNFNRHQRVHT 515
            .|.||||||..|.:  ||:.|:..:..:.|.:.|||||||.||.  |.::|...:|:..|.|:||
Zfish   322 TRIHTGEKPFLCPFPGCGRSFTTSNICKVHVRTHTGEKPYHCPEPGCNRAFASATNYKNHIRIHT 386

Human   516 GE------------------------------KPYKCSHCGKSFSWSSSLDKHQRS-HLGKKPFQ 549
            ||                              |||||:||||::...|:|..|:|| |...:|.:
Zfish   387 GERPYVCTVPGCDKRFTEYSSLYKHNVVHTPCKPYKCNHCGKTYKQISTLVMHKRSAHNDSEPIE 451

Human   550  549
            Zfish   452  451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF18NP_001290210.1 SCAN 37..148 CDD:322011
KRAB <222..249 CDD:307490 6/26 (23%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
COG5048 <436..549 CDD:227381 55/149 (37%)
C2H2 Zn finger 438..458 CDD:275368 10/21 (48%)
C2H2 Zn finger 466..486 CDD:275368 5/21 (24%)
zf-H2C2_2 479..503 CDD:316026 12/25 (48%)
C2H2 Zn finger 494..514 CDD:275368 7/21 (33%)
zf-H2C2_2 506..530 CDD:316026 16/53 (30%)
C2H2 Zn finger 522..542 CDD:275368 10/20 (50%)
znf143aNP_001007442.1 COG5048 <203..411 CDD:227381 73/248 (29%)
C2H2 Zn finger 243..265 CDD:275368 5/41 (12%)
zf-H2C2_2 257..284 CDD:290200 12/45 (27%)
C2H2 Zn finger 273..295 CDD:275368 9/24 (38%)
zf-H2C2_2 288..314 CDD:290200 13/25 (52%)
C2H2 Zn finger 303..325 CDD:275368 10/21 (48%)
zf-H2C2_2 317..344 CDD:290200 14/26 (54%)
C2H2 Zn finger 333..355 CDD:275368 5/21 (24%)
zf-H2C2_2 349..374 CDD:290200 12/24 (50%)
C2H2 Zn finger 363..385 CDD:275368 7/21 (33%)
zf-H2C2_2 377..403 CDD:290200 7/25 (28%)
C2H2 Zn finger 393..415 CDD:275368 0/21 (0%)
C2H2 Zn finger 423..441 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.