Sequence 1: | XP_016882693.1 | Gene: | ZNF708 / 7562 | HGNCID: | 12945 | Length: | 587 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 78/196 - (39%) |
---|---|---|---|
Similarity: | 108/196 - (55%) | Gaps: | 17/196 - (8%) |
- Green bases have known domain annotations that are detailed below.
Human 247 TGEKLYKCEECGK---AFNRSS---NLTKHKIVHTGEKP------YKCEECGKAFKQSSNLTNHK 299
Human 300 KIHTGEKPYKCGECGKAFTLSSHLTTHKRIHTGEKPYKCEECGKAFSVFSTLTKHKIIHTEEKPY 364
Human 365 KCEECGKAFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKSSTLTYHKVIHTGKKPYK--CEECGK 427
Human 428 A 428 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZNF708 | XP_016882693.1 | None | |||
trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
COG5048 | <264..411 | CDD:227381 | 64/146 (44%) | ||
C2H2 Zn finger | 274..294 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 287..311 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 302..322 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 315..338 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 330..350 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 345..367 | CDD:290200 | 11/21 (52%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 370..394 | CDD:290200 | 14/23 (61%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 8/19 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |