DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF708 and ranshi

DIOPT Version :9

Sequence 1:XP_016882693.1 Gene:ZNF708 / 7562 HGNCID:12945 Length:587 Species:Homo sapiens
Sequence 2:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster


Alignment Length:368 Identity:96/368 - (26%)
Similarity:139/368 - (37%) Gaps:78/368 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   132 VTTTQSKIVQCDKYVKVFHKYSNAKRHKIR-HTGKNPFKCKECGKSFCMLSQL------------ 183
            |..|..|....::.:.:|.|.:......|: .||.....|.......|...|.            
  Fly     5 VCRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCSTLPNRLCASCQTCLQQAISFRERC 69

Human   184 --TQHEIIHTGEKP---YKCEECGKAFKKSSNL---------TNHKIIHTGEKPYKCEECGKAFN 234
              .|.|::|:.:..   ..|:|..|:..:...|         ...::....|.|.:    ...|.
  Fly    70 LEVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDLNEGPIQ----SSGFK 130

Human   235 QSSTLTRHKI----------IHTGEKLYKCEECGKAFNRSSNLTKHKIVHTGEKPYK-------- 281
            ....|...||          |...|..|...|.....:     .|.::....|.|.|        
  Fly   131 VEDILNESKINEDEPNNEDDIDYSEMDYLIYESDTEVD-----AKQELKSDSENPKKRRNRRNPR 190

Human   282 -------CEECGKAFKQSSNLTNHKKIHTGEKPYKCGECGKAFTLSSHLTTHKRIHTGEKPYKCE 339
                   |||||...|...:...|.|.|.|.|.:.|..|...|...:.|..|.|.||||||:||.
  Fly   191 DSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCR 255

Human   340 ECGKAFSVFSTLTKHKIIHTEEKPYKCEECGKAFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKS 404
            .|.::||.:||..||:..||.|:|:.|:||..||..|..|.||.::|||||.::|:.|.|.|::.
  Fly   256 HCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRY 320

Human   405 STLTYHKVIHTGKKPYKCEECGKAFSIFSILTKHKVIHTEDKP 447
            :.||.|...:..::..:     ||.:||            |||
  Fly   321 THLTTHYRSNAHRRNMQ-----KADTIF------------DKP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF708XP_016882693.1 None
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 13/71 (18%)
C2H2 Zn finger 198..218 CDD:275368 8/19 (42%)
COG5048 222..>276 CDD:227381 23/53 (43%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 9/19 (47%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.