DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF8 and CG17802

DIOPT Version :9

Sequence 1:NP_066575.2 Gene:ZNF8 / 7554 HGNCID:13154 Length:575 Species:Homo sapiens
Sequence 2:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster


Alignment Length:407 Identity:88/407 - (21%)
Similarity:146/407 - (35%) Gaps:126/407 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    19 ARLQEPVTFRDVA--VDFTQEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQGT 81
            :.:.|...|.|:|  :.|::|:..|   .|:..|.|::.:..||                 :.|.
  Fly   137 SEVNENKEFEDIACEIPFSKEDDEQ---EQQQEYEDMVDKKTGH-----------------DDGE 181

Human    82 ELWVAERGTTQGCHPAWEPRSESQASRKEEGLPEEEPSHVTGREGFPTDAPYPTTLGKDRECQSQ 146
            |        :|.|..:.....|||.:.::|...:|:...:...|...:|....:.  .|.|..|:
  Fly   182 E--------SQECEESQPDEEESQQNEEDEEESQEDDDELWQNEDGDSDTDADSM--SDIEATSR 236

Human   147 SLALKEQNNLKQLEFGLKEAPVQDQGYKTLRLRENCVLSSSPNPFPEISRGEYLYTYDSQITDSE 211
            ..||.|....:: ::..:.:|..|                                         
  Fly   237 QSALDEDKKPRR-KYTKRSSPKND----------------------------------------- 259

Human   212 HNSSLVSQQTGSPGKQPGENSDCHRDSSQAIPITELTKSQVQDKPYKCTDCGKSFNHNAHLTVHK 276
                                     |:....|..:..|:.:..|.:.|..|||.|....:..:|.
  Fly   260 -------------------------DTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHV 299

Human   277 RIHTGERPYMCKECGKAFSQNSSLVQHERI-HTGDKPYKCAECGKSFCHSTHLTVH-RRIHTGEK 339
            ..|:|.:|:.|.|||:.......|..|.|: |.|:|||.|..|.:.|.|||..:.| .|:|..:|
  Fly   300 LRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVHRNKK 364

Human   340 P---YECQDCGRAFNQNSSLGRHKRTHTGEKPYTCSVCGKSFSRTTCLFLHLRTHTEERPYECNH 401
            .   ::|..|.:.:..|....:|:..||||:.:.|.||..||:|.:    :|:||...|      
  Fly   365 TPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNS----NLKTHYRSR------ 419

Human   402 CGKGFRHSSSLAQHQRK 418
                        |||.|
  Fly   420 ------------QHQNK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF8NP_066575.2 KRAB 25..85 CDD:214630 13/61 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..130 8/37 (22%)
COG5048 <167..404 CDD:227381 55/241 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..237 0/26 (0%)
C2H2 Zn finger 259..279 CDD:275368 6/19 (32%)
C2H2 Zn finger 287..307 CDD:275368 7/20 (35%)
C2H2 Zn finger 315..335 CDD:275368 8/20 (40%)
C2H2 Zn finger 343..363 CDD:275368 4/19 (21%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
zf-C2H2 397..419 CDD:306579 4/22 (18%)
C2H2 Zn finger 399..419 CDD:275368 4/20 (20%)
zf-C2H2 467..489 CDD:306579
C2H2 Zn finger 469..489 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..533
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 7/20 (35%)
C2H2 Zn finger 339..360 CDD:275368 8/20 (40%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 10/44 (23%)
C2H2 Zn finger 399..417 CDD:275368 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.