DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF8 and CG17806

DIOPT Version :9

Sequence 1:NP_066575.2 Gene:ZNF8 / 7554 HGNCID:13154 Length:575 Species:Homo sapiens
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:353 Identity:90/353 - (25%)
Similarity:139/353 - (39%) Gaps:66/353 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   105 QASRKEEGLP---EEEPSHVTGREGFPTDAPY--PTTLGKDRECQSQSLALKEQNNLKQLEFGLK 164
            |.|:|.:|:|   .|.|.       :|...|.  |..|.....|: ..:.:|.:..|.      .
  Fly   118 QRSKKVDGVPLKTVETPI-------YPLVVPEIPPADLVDPLRCE-DPIQVKSEPQLS------S 168

Human   165 EAPVQDQGYKTLRLRENCVLSSSPNPFPEISRGEYLYTYDSQITDSEHNSSLVSQQTGSPGKQPG 229
            :.||:...::........|:...|.....|  ||                  |.:....| :..|
  Fly   169 DYPVESMNHEEPASEMPQVMKEEPRTLQVI--GE------------------VQKNRRKP-RSKG 212

Human   230 ENSDCHRDSSQAIPITELTKSQVQDKPYKCTD-CGKSFNHNAHLTVHKRIHTGE-RPYMCKECGK 292
            ...:|.......|...:.|.::.:::.|...: .|.:          ||.:..| |.|.|.:|||
  Fly   213 CLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAA----------KRAYALEHRLYFCDQCGK 267

Human   293 AFSQNSSLVQHERIHTGDKPYKCAECGKSFCHSTHLTVHRRI-HTGEKPYECQDCGRAFNQNSSL 356
            .||:..:...|.|.|.|.|.::|.||.:.......|.:|.|| |.||.||.|:.||:.|:.....
  Fly   268 TFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKR 332

Human   357 GRHKRTHTG---EKPYTCSVCGKSFSRTTCLFLHLRTHTEERPYECNHCGKGFRHSSSLAQHQR- 417
            ..|:|.|..   .:|:.||.|.|:|..:|.|..|:..||.|:|:.|..|...|...::||.|.: 
  Fly   333 LNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKS 397

Human   418 KHAGEKPFECRQRLIFEQTPALTKHEWT 445
            ||         .||..|:...:.|.:.|
  Fly   398 KH---------HRLKVEEQSKMPKMDAT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF8NP_066575.2 KRAB 25..85 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..130 8/27 (30%)
COG5048 <167..404 CDD:227381 65/242 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..237 4/26 (15%)
C2H2 Zn finger 259..279 CDD:275368 3/20 (15%)
C2H2 Zn finger 287..307 CDD:275368 8/19 (42%)
C2H2 Zn finger 315..335 CDD:275368 7/20 (35%)
C2H2 Zn finger 343..363 CDD:275368 6/19 (32%)
C2H2 Zn finger 371..391 CDD:275368 8/19 (42%)
zf-C2H2 397..419 CDD:306579 6/22 (27%)
C2H2 Zn finger 399..419 CDD:275368 6/20 (30%)
zf-C2H2 467..489 CDD:306579
C2H2 Zn finger 469..489 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..533
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 31/84 (37%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 12/40 (30%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.