Sequence 1: | NP_066575.2 | Gene: | ZNF8 / 7554 | HGNCID: | 13154 | Length: | 575 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
Alignment Length: | 271 | Identity: | 84/271 - (30%) |
---|---|---|---|
Similarity: | 124/271 - (45%) | Gaps: | 39/271 - (14%) |
- Green bases have known domain annotations that are detailed below.
Human 141 RECQSQSLALKEQNNLKQLEFG-----------LKEAPVQDQGYKTLR-LRENCVLSSSPNPFPE 193
Human 194 ISRGEYLY-TYDSQITDSEHNSSLVSQQTGSPGKQPGE--NSDCHRDSSQAIPITELTKSQVQDK 255
Human 256 PYKCTDCGKSFNHNAHLTVHKRIHTGERPYMCKECGKAFSQNSSLVQHERIHTGDKPYKCAECGK 320
Human 321 SFC-HSTHLTVHRRIHTGEKPYECQDCGRAFNQNSSLGRHKRTHTGEKPYTCSVCGKSFSRTTCL 384
Human 385 FLHLRTHTEER 395 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZNF8 | NP_066575.2 | KRAB | 25..85 | CDD:214630 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 92..130 | ||||
COG5048 | <167..404 | CDD:227381 | 75/234 (32%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 210..237 | 5/28 (18%) | |||
C2H2 Zn finger | 259..279 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 287..307 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 315..335 | CDD:275368 | 9/20 (45%) | ||
C2H2 Zn finger | 343..363 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 371..391 | CDD:275368 | 10/19 (53%) | ||
zf-C2H2 | 397..419 | CDD:306579 | |||
C2H2 Zn finger | 399..419 | CDD:275368 | |||
zf-C2H2 | 467..489 | CDD:306579 | |||
C2H2 Zn finger | 469..489 | CDD:275368 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 488..533 | ||||
ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
C2H2 Zn finger | 198..218 | CDD:275368 | 4/19 (21%) | ||
COG5048 | 222..>276 | CDD:227381 | 22/54 (41%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 238..262 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 254..274 | CDD:275368 | 9/20 (45%) | ||
zf-H2C2_2 | 269..291 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 295..319 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 310..328 | CDD:275368 | 9/17 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |