DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF8 and wor

DIOPT Version :9

Sequence 1:NP_066575.2 Gene:ZNF8 / 7554 HGNCID:13154 Length:575 Species:Homo sapiens
Sequence 2:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster


Alignment Length:380 Identity:103/380 - (27%)
Similarity:158/380 - (41%) Gaps:65/380 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    66 PELPKPEVI----SQLEQGTELWVAERGTTQGCHPAWEPRSESQASRKEEGLPEEEPSHVTGREG 126
            |.:|.|::.    :.|.:..:|.|.:|....      |..:....:|....:....|.|      
  Fly   187 PPIPSPQLFYPPPTPLAEPEDLSVTQRRVLS------ENMNLQNVARALLSMQHMAPQH------ 239

Human   127 FPTDAPYPTTLGKDRECQS-QSLALKEQNNLKQLEFGLKEAPVQDQGYKTLRLRENCVLSSSPNP 190
                ||.|..:.:|:|.|. ..|.:|..|:|                |...:....|..:     
  Fly   240 ----APPPIDMEEDQENQDINQLKIKSSNDL----------------YYQCQQCNKCYAT----- 279

Human   191 FPEISRGEYLYTYDSQITDSEHNSSLVSQQTGSPGKQPGENSDCHRDSSQAIPITELTKSQVQDK 255
            :..:.:.:..:.|:|    :|:  .::..|.|..|....:...|...:|..|....:..:|...|
  Fly   280 YAGLVKHQQTHAYES----TEY--KIIRSQPGGSGAIVDQTEFCTDQASALIQAANVASAQSMQK 338

Human   256 P-----YKCTDCGKSFNHNAHLTVHKRIHTG-------ERPYMCKECGKAFSQNSSLVQHERIHT 308
            |     |.|.|||||::..:.|:.|::.|..       ::.:.||.|.|.:....:|..|.|.||
  Fly   339 PVGVPRYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHT 403

Human   309 GDKPYKCAECGKSFCHSTHLTVHRRIHTGEKPYECQDCGRAFNQNSSLGRHKRTHTGEKPYTCSV 373
              .|.||..|||:|.....|..|.|.||||||:.||.|.|||...|:|..|.:||:..|.|:|..
  Fly   404 --LPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPT 466

Human   374 CGKSFSRTTCLFLHLRTHTE-ERPYECNHCGKGFRHSSSLAQH-QRKHAGEKPFE 426
            |.|||||.:.|..||::..: |:....:..|.|| ....|.|| |....|..|.:
  Fly   467 CTKSFSRMSLLAKHLQSGCQTEQSGGPSGSGGGF-DQQQLQQHLQVYEEGHNPHQ 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF8NP_066575.2 KRAB 25..85 CDD:214630 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..130 4/37 (11%)
COG5048 <167..404 CDD:227381 73/249 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..237 5/26 (19%)
C2H2 Zn finger 259..279 CDD:275368 8/19 (42%)
C2H2 Zn finger 287..307 CDD:275368 7/19 (37%)
C2H2 Zn finger 315..335 CDD:275368 8/19 (42%)
C2H2 Zn finger 343..363 CDD:275368 9/19 (47%)
C2H2 Zn finger 371..391 CDD:275368 10/19 (53%)
zf-C2H2 397..419 CDD:306579 7/22 (32%)
C2H2 Zn finger 399..419 CDD:275368 7/20 (35%)
zf-C2H2 467..489 CDD:306579
C2H2 Zn finger 469..489 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..533
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 1/24 (4%)
C2H2 Zn finger 317..334 CDD:275368 3/16 (19%)
zf-C2H2 345..367 CDD:278523 9/21 (43%)
C2H2 Zn finger 347..367 CDD:275368 8/19 (42%)
PHA00732 379..>417 CDD:177300 16/39 (41%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
zf-C2H2_8 405..482 CDD:292531 38/76 (50%)
zf-C2H2 406..428 CDD:278523 9/21 (43%)
C2H2 Zn finger 408..428 CDD:275368 8/19 (42%)
zf-H2C2_2 421..444 CDD:290200 14/22 (64%)
zf-C2H2 434..456 CDD:278523 9/21 (43%)
C2H2 Zn finger 436..456 CDD:275368 9/19 (47%)
zf-H2C2_2 448..473 CDD:290200 11/24 (46%)
C2H2 Zn finger 464..481 CDD:275368 8/16 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2499
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.