DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIC2 and iec1

DIOPT Version :9

Sequence 1:NP_009060.2 Gene:ZIC2 / 7546 HGNCID:12873 Length:532 Species:Homo sapiens
Sequence 2:NP_594663.1 Gene:iec1 / 2542854 PomBaseID:SPAC144.02 Length:249 Species:Schizosaccharomyces pombe


Alignment Length:120 Identity:39/120 - (32%)
Similarity:58/120 - (48%) Gaps:27/120 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   253 KQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVS----------------VEHVGGPEQSNHV 301
            :.|.||.|          :||.:...|:..||.|:.                ::|:|. .:..:.
pombe    21 ESETICHW----------QSCEQDLLTLDNLVHHIHNGTTSNLRLISNINSILDHIGN-RRPKYT 74

Human   302 CFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRT 356
            |.|::|||:|....:::.||.|:|.|||||||.|..|.|.:.|.||:.|..|.||
pombe    75 CEWDDCPRKGMVQTSRFALVAHLRSHTGEKPFICSVPECDRSFTRSDALAKHMRT 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIC2NP_009060.2 Necessary for interaction with MDFIC and transcriptional activation or repression. /evidence=ECO:0000250 100..255 0/1 (0%)
zf_ZIC 250..295 CDD:408166 12/57 (21%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
SFP1 <329..413 CDD:227516 15/28 (54%)
C2H2 Zn finger 335..357 CDD:275368 10/22 (45%)
C2H2 Zn finger 365..387 CDD:275368
C2H2 Zn finger 395..415 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..452
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..532
iec1NP_594663.1 COG5048 1..>249 CDD:227381 39/120 (33%)
zf-H2C2_2 92..119 CDD:290200 15/26 (58%)
C2H2 Zn finger 108..129 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.