DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFX and CG1647

DIOPT Version :9

Sequence 1:NP_001317256.1 Gene:ZFX / 7543 HGNCID:12869 Length:844 Species:Homo sapiens
Sequence 2:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster


Alignment Length:289 Identity:62/289 - (21%)
Similarity:99/289 - (34%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   585 FPHICVECGKGFRH--------PSELKKHMRIHTGEKPY--------QCQYCEYRSADSSNLKTH 633
            |..:|....|..|:        |:.|....||...|:|.        :.:..|.....::|:|..
  Fly    85 FREMCYATNKQTRNLLGLKQIEPARLIDLKRIVKEERPISGAVGKRGRKRKGEESWPKNNNVKPQ 149

Human   634 VKTK----HSKEMPFKCDICLLTFSDTKEVQQHALIHQES---------KTHQCLHCDHKSSNSS 685
            ||.:    |.|:......|..|......|::........|         :...|..|..|..:..
  Fly   150 VKKESFVWHKKQKLQPSQITSLVSKREPEIKDEPAEQDTSLKGPPKKAGRKSICSVCGEKFLSKE 214

Human   686 DLKRHIISVHTKDYP-HKCDMCDKGFHRPSELKKHVAAHK-GKKMHQCRHCDFKIADPFVLSRHI 748
            ....|...||....| :.|:.|::..|..|:::.|...|| .|..::|..|:..:|:.:..:|| 
  Fly   215 LADEHKSLVHVPSIPRYICNACNQTHHNQSDIRAHQLWHKLSKTPYKCPLCESSVANAYAFTRH- 278

Human   749 LSVHTKDLPFR-------CKRCRKGFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVI 806
            |..||...|.:       |..|:|.|........|......||   |..|..:....:.:.||..
  Fly   279 LREHTPPTPVQLLVLDRECPLCKKTFVTNFFYNTHRCAIRKRK---CGGCSRTLNTEAAYMRHAP 340

Human   807 SIHTKDYPHRCEYCKKGFRRPSEKNQHIM 835
            :            |.|.:...|   :|||
  Fly   341 T------------CPKIYLNHS---KHIM 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFXNP_001317256.1 None
CG1647NP_651636.1 zf-AD 19..99 CDD:285071 4/13 (31%)
C2H2 Zn finger 203..224 CDD:275368 4/20 (20%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..282 CDD:275368 6/20 (30%)
C2H2 Zn finger 297..314 CDD:275368 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.