DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFPL1 and CG5382

DIOPT Version :9

Sequence 1:NP_006773.2 Gene:ZFPL1 / 7542 HGNCID:12868 Length:310 Species:Homo sapiens
Sequence 2:NP_732721.1 Gene:CG5382 / 42618 FlyBaseID:FBgn0038950 Length:299 Species:Drosophila melanogaster


Alignment Length:316 Identity:132/316 - (41%)
Similarity:170/316 - (53%) Gaps:38/316 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRET 65
            |||||||||.|||.|||||||||||||:|.:|.|||||||||||:||||..||.||...|...:.
  Fly     1 MGLCKCPKRLVTNQFCFEHRVNVCEHCMVQSHPKCIVQSYLQWLRDSDYISNCTLCGTTLEQGDC 65

Human    66 TRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALREKLATVNWARA 130
            .|||||.:|||.|||.|.|.||.||||.|:|||:|:..|||..||..|||.||:..|:.|||.|.
  Fly    66 VRLVCYHVFHWDCLNARQAALPANTAPRGHQCPACSVEIFPNANLVSPVADALKSFLSQVNWGRN 130

Human   131 GLGLPLIDEVVSP-----EPEPLNTSDFSDWSSFNASSTPG------PEEVDSASAAPAFYSQAP 184
            ||||.|:.|..|.     :|:..:.:..|:.:..:...:.|      |...|:.|........|.
  Fly   131 GLGLALLSEEQSSSLKAIKPKVASQAAVSNMTKVHHIHSGGERERTKPNGHDAVSPHSVLLMDAF 195

Human   185 RPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLR 249
            .||::..        :..:..||  .||         ::|....|.||:||:||......:|..|
  Fly   196 NPPSAGD--------YASSRRPL--LPR---------QSPIGGTDRDDNKYQRRTPAELFSRWTR 241

Human   250 SRAGSRKRPLTLLQRAGLLLLLGLLGFLALLALMSRLGRAAAD------SDPNLDP 299
            .......||  ..:|...|:..|:|.|:..:.||:.|||..:|      ::||..|
  Fly   242 RFYAPSSRP--PWRRTWFLVTAGILAFVLFVYLMAWLGRGGSDAVDEGWNNPNPQP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFPL1NP_006773.2 mRING-H2-C3DHC3_ZFPL1 50..104 CDD:319401 29/53 (55%)
modified RING-H2 finger (C3DHC3-type) 53..100 CDD:319401 27/46 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..231 15/91 (16%)
CG5382NP_732721.1 zf-RING_2 52..100 CDD:290367 28/47 (60%)
TctB <235..>277 CDD:284693 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147115
Domainoid 1 1.000 221 1.000 Domainoid score I2613
eggNOG 1 0.900 - - E1_KOG3970
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4935
Inparanoid 1 1.050 222 1.000 Inparanoid score I3547
Isobase 1 0.950 - 0 Normalized mean entropy S3613
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489858at33208
OrthoFinder 1 1.000 - - FOG0006162
OrthoInspector 1 1.000 - - oto90462
orthoMCL 1 0.900 - - OOG6_105755
Panther 1 1.100 - - LDO PTHR12981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4450
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.710

Return to query results.
Submit another query.