DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFP36 and Tis11

DIOPT Version :9

Sequence 1:NP_003398.3 Gene:ZFP36 / 7538 HGNCID:12862 Length:326 Species:Homo sapiens
Sequence 2:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster


Alignment Length:324 Identity:106/324 - (32%)
Similarity:124/324 - (38%) Gaps:105/324 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    86 ELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKF 150
            |.:.|...|.......|||||||||.|.|:|.|:||.|||||||..|||..:||||||||.|..|
  Fly   118 ERTQSEPLPPQQPMNTSRYKTELCRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKYKTEYCRTF 182

Human   151 YLQGRCPYGSRCHFIHNPSEDLA--APGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSF 213
            :..|.||||.||||:||..|..|  |........||.|.|...|.:..||.....:..|.:|||.
  Fly   183 HSVGFCPYGPRCHFVHNADEARAQQAAQAAKSSTQSQSQSQQSSSQNFSPKSNQSSNQSSNSSSS 247

Human   214 SPSS----------------------SPP-----------PPGDLPLSP---------------- 229
            |.||                      |||           |.|.|.|||                
  Fly   248 SSSSGGGGGGGNSINNNNGSQFYLPLSPPLSMSTGSDRESPTGSLSLSPTNSLTSFPFHDALQHG 312

Human   230 -------------SAFSAAPGTPL------------------ARRDP-TPVCCPSCRRATPISVW 262
                         |:.|:|.|..|                  ....| ||...|:    .|||. 
  Fly   313 YLASNGAKSNSSASSTSSASGMGLGMSMGIGQGMIIGQGLGMGHHGPATPPESPN----VPISP- 372

Human   263 GPLGGLVRTPSVQSLGSDPDEYASSGSSLGGS---DSPVFEAGVFAPPQPVAAPRRLPIFNRIS 323
                  |.||       .|.:...|||..|.:   ...:.:..|..|.|....| |||:|||:|
  Fly   373 ------VHTP-------PPYDVVVSGSGAGNNSVGSKQLLQKSVSTPMQQEDTP-RLPVFNRLS 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFP36NP_003398.3 Necessary for localization of ARE-containing mRNAs to processing bodies (PBs). /evidence=ECO:0000269|PubMed:17369404 1..174 51/89 (57%)
Necessary and sufficient for the association with mRNA decay enzymes and mRNA decay activation. /evidence=ECO:0000269|PubMed:15687258 1..100 3/13 (23%)
Necessary for nuclear export. /evidence=ECO:0000250|UniProtKB:P47973 1..15
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..102 3/15 (20%)
Necessary for nuclear localization. /evidence=ECO:0000250|UniProtKB:P47973 95..168 45/72 (63%)
Necessary for RNA-binding. /evidence=ECO:0000269|PubMed:10751406, ECO:0000269|PubMed:12748283 97..173 47/75 (63%)
Necessary for localization of ARE-containing mRNAs to processing bodies (PBs). /evidence=ECO:0000269|PubMed:17369404 100..326 103/310 (33%)
Necessary for interaction with PABPN1. /evidence=ECO:0000250|UniProtKB:P22893 103..194 53/92 (58%)
zf-CCCH <104..>200 CDD:325094 54/97 (56%)
Necessary for mRNA decay activation. /evidence=ECO:0000269|PubMed:15687258 174..326 55/234 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..245 28/149 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..292 4/18 (22%)
Interaction with CNOT1. /evidence=ECO:0000269|PubMed:23644599 312..326 8/12 (67%)
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 18/24 (75%)
zf-CCCH 174..198 CDD:279036 15/23 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2657
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000616
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12547
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2078
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.