DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF1 and qkr58E-3

DIOPT Version :9

Sequence 1:NP_001365886.1 Gene:SF1 / 7536 HGNCID:12950 Length:764 Species:Homo sapiens
Sequence 2:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster


Alignment Length:350 Identity:83/350 - (23%)
Similarity:134/350 - (38%) Gaps:89/350 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   201 PEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHN----------LITEMV------ALNPDFK 249
            |.:.:....|.::.: .|||....:....|:|||..          ||.|.|      ...|..:
  Fly     4 PSEFTEKQPPTHDHQ-PRLNEVAQKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPGKE 67

Human   250 PPAD-YKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKV 313
            ..|| ||....:::.||.:|..:||:.||.|.::||:||:|:.:::|...||.|:|:.|:::   
  Fly    68 FYADVYKQKPMKITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRD--- 129

Human   314 GRKDGQMLPGEDEPLHA-------------LVTANTMENVKKAVEQIRNILKQGIETPEDQNDLR 365
             |...:.|....:|.:|             ...|.....:..|:.:||..|     .|:..:::.
  Fly   130 -RNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYL-----IPDKNDEVS 188

Human   366 KMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQD 430
            ..|||||..::   .|....|..| .....||:.:    .|.||..:          |.|     
  Fly   189 HEQLRELMEMD---PESAKNIHGP-NLEAYRSVFD----KKFGGNSN----------GAP----- 230

Human   431 KARMDKEYLSLMAELGEAP--------VPASVGSTSGPATTPLA---SAPRPA-----APANNPP 479
                  :|::|:....|.|        |.........|...|..   |.|||:     |.|...|
  Fly   231 ------KYINLIKRAAENPPEVDDVEEVAYEYEHRMPPKRPPTGYEYSKPRPSIIPTNAAAYKRP 289

Human   480 PPSLMSTTQSRPPWMNSGPSESRPY 504
            .|:.|...: .||..:..|:   ||
  Fly   290 YPTDMKRMR-EPPIKSYKPN---PY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF1NP_001365886.1 MSL5 142..382 CDD:227503 52/210 (25%)
ZnF_C2HC 403..418 CDD:197667 3/14 (21%)
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.