DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YWHAZ and 14-3-3epsilon

DIOPT Version :9

Sequence 1:NP_001129171.1 Gene:YWHAZ / 7534 HGNCID:12855 Length:245 Species:Homo sapiens
Sequence 2:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster


Alignment Length:245 Identity:164/245 - (66%)
Similarity:197/245 - (80%) Gaps:4/245 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIE 66
            ::...|.||||||||||||:|...||.|.....||:.|||||||||||||:||||:|||:::|||
  Fly     3 ERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIE 67

Human    67 QKTE--GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYL 129
            ||.|  |||:|.:|.:.||.::|.||||||:|:|::|||.|||.|:..||||||.||||||:|||
  Fly    68 QKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYL 132

Human   130 AEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKT 194
            ||.|.|.|:|...:.|..||:.|.:|:..::.||||||||||||||||||||||||::||.|||.
  Fly   133 AEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197

Human   195 AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAE--AGEG 242
            |||:|||||||||||||||||||||||||||||||||.|.:|.:  ||:|
  Fly   198 AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YWHAZNP_001129171.1 14-3-3_beta_zeta 2..230 CDD:206758 156/229 (68%)
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 156/228 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1059
SonicParanoid 1 1.000 - - X206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.